1YOX


Conserved Protein Domain Family
AIM24

?
pfam01987: AIM24 
Click on image for an interactive view with Cn3D
Mitochondrial biogenesis AIM24
In eukaryotes, this domain is involved in mitochondrial biogenesis. Its function in prokaryotes in unknown.
Statistics
?
PSSM-Id: 426549
Aligned: 462 rows
Threshold Bit Score: 63.296
Created: 26-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1YOX_D        10 YRILGESXQTVEIELDPGETVIAEAGAXNYXTGDIRftarxgdgsdgs-llgklwsagkrkLGGESVFXTHFTn-eGQGK 87  Pseudomonas aer...
XP_004981795  25 FQISGGDVQVLQVMLKSQEKLTAKPGTMCYMSGNMQmdnnylpe---------ndggvwqwIFGKSVSSTVFFntgS-DD 94  foxtail millet
XP_009415295  25 FQILGGESQIVQIMLKSQEKLIAKPGAMCYMSGSIQmdnnyipe---------heagfwqwLFGRSVTSIVLCnlgP-ED 94  wild Malaysian ...
XP_009393028  25 FQILGGESQIVQIMLKAQEKLIAMPGTVYYISGSIQmdnnyipe---------neagfwqwIFGKRVTSVVISnsgP-ED 94  wild Malaysian ...
XP_004244562  25 FQILGGEAQIVQIMLKPQERIIAKPGSMCYMSGSIQmenvyaae---------neagvwqwLFGKNTTSIVLHntgT-TD 94  tomato
Q8RXM5        25 FQILGGESQVVQIMLKSEEKVIAKPASMCYMSGSIEmentytpe---------qevgvlqwILGKSVSSVVLRntgQ-ND 94  thale cress
XP_002868070  25 FQILGGEAQVVQIMLKPQEKVIAKPGSMCYMSGSIQmdnnytpe---------qevgvvqwILGKSVSSIVLRnngQ-ND 94  Arabidopsis lyr...
XP_006579422  25 FQILGGEAQVVQIMLKPQEKIIAKPGSMCFMSGSVEmenaylpe---------nevgiwqwLFGKTITSIVLRnsgP-SD 94  soybean
EEF31733      65 FQILGGEAQVVQIMLKPQEKVVAKPGSMCFMSGSIEmentflpe---------nevgmwqwLFGKTVTSIVLRnsgP-SD 134 castor bean
CBJ49032      20 FLSLGEGSEVLQVALCPGDAILANEKAFVYRglglqqelqptgpmgralgwigvkndrvvkFTNEG-----------NSP 88  Ectocarpus sili...
1YOX_D        88 QHVAFAAPYPGSVVAVD-LDdvGG-RLFCQKDSFLCAAYGTrvgiaft---krlgagfFGg--eG-FILQKLEGDGLVFV 159 Pseudomonas aer...
XP_004981795  95 GYVGIAAPFPGRILPVD-LAnfGG-ELLCHADAFLCSVNDVsvtstve---prprnieIGa--eM-ILKQKLRGQGMAFL 166 foxtail millet
XP_009415295  95 GFVGIAAPSPARILPID-LAnfGG-EILCQPDAFLCSVNDVrtisnvd---qrprnfeVGa--eV-ILKQKLVGQGLAFL 166 wild Malaysian ...
XP_009393028  95 GFVGIAAPSPARILPID-LAnfGG-EILCQPDAFLCSVNDVrvssrvd---qrprnleVGa--eL-ILKQKLEGQGLAFL 166 wild Malaysian ...
XP_004244562  95 GFVGIAAPSLARILPID-LAkfGG-EILCQPDAFLCSINDVkvsntid---qrprnlvASa--eG-FLRQKISGQGLAFV 166 tomato
Q8RXM5        95 GFVGIAAPYLARILPID-LAmfGG-EILCQPDAFLCSVHDVkvvnsvdq--rarnivaAGa--eG-FLRQRLSGQGLAFI 167 thale cress
XP_002868070  95 GFVGIAAPSLARILPLD-LAmfGG-DILCQPDAFLCSVHDVkvvnslyqrhrarniaqAGa--eG-FLRQRLSGQGLAFI 169 Arabidopsis lyr...
XP_006579422  95 GFVGIAAPYFARILPID-LAmfNG-EILCQPDAFLCSVNDVkvsnivd---qrgrnavASa--eG-FLRQKLSGQGLAFI 166 soybean
EEF31733     135 GFIGIAAPSLARILPID-LAmfGG-EILCQPDAFLCSVNDVkvsstvd---yrarnvmASa--eG-FLRQKLSGQGLAFV 206 castor bean
CBJ49032      89 TYLGLTASLPGKVIPVSlA---KSgTLLAKPSVFLCSVVENdistak------iklqseGqssqQsVEMRKIAGAGMCYI 159 Ectocarpus sili...
1YOX_D       160 HAGGTLIRRQLN-GETLRVDTGCLVAFTDGIDYDVQLA-GGLKSXLFGGEGLlLTTLKGSGTVWLQSL 225 Pseudomonas aeruginosa PAO1
XP_004981795 167 VGGGSVMQKILApQEVITVDAACIVAMTTTINFQLKSP-NQLRRAVFGGENQlTASLTGPGVVFIQSL 233 foxtail millet
XP_009415295 167 AGCGSVVQKILApGEVLIVDAVCIVAMTCTINFQLKHS-HPMRRVVFGGDNQlMATLSGPGVVFIQSL 233 wild Malaysian banana
XP_009393028 167 LGCGSVVQKILApGEVFIVDAACIIAMTSSINFQLKYS-SPMRRVVFRGDNQlMATLSGPGVVFIQSL 233 wild Malaysian banana
XP_004244562 167 VGGGSVVQKNLEvGEVLAVDVPSVVALSSTVNVQVKYN-GPMRRVVFGNDNLvTAVLTGPGIVFIQSM 233 tomato
Q8RXM5       168 LAGGSVVQKVLEvGEVFSIDVSCIAALTPSIDVRIKNN-APFRRALFGGDNVvMATLTGPGIVFIQSL 234 thale cress
XP_002868070 170 IAGGSVVQKNLEvGEVLTTDVSCIAALTPSINFQIKYNaAPVRRAVFGGENLvTATLTGPGIVFIQSL 237 Arabidopsis lyrata subsp. l...
XP_006579422 167 LAGGSVVQKNLEiGEVLAVDVSSIVAVTSAVNIQIKYN-GPARRTMFGGDNAvTAVLTGPGIVFIQSL 233 soybean
EEF31733     207 VGGGSVIQKNLEvGEVLSVDVSCIVAVNTTVNVQVKYN-GPMRRAVFGGDNLvTATLTGPGIVFIQSL 273 castor bean
CBJ49032     160 HGGGAAVQKALGrGESMVVEFGCVAAVSDACKivpeerngplireppyfQGF-QVKITGPGSVFIQST 226 Ectocarpus siliculosus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap