1XTY,1RLK,2ZV3,3ERJ


Conserved Protein Domain Family
PTH2

?
pfam01981: PTH2 
Click on image for an interactive view with Cn3D
Peptidyl-tRNA hydrolase PTH2
Peptidyl-tRNA hydrolases are enzymes that release tRNAs from peptidyl-tRNA during translation.
Statistics
?
PSSM-Id: 426544
Aligned: 278 rows
Threshold Bit Score: 55.919
Created: 26-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1XTY_D               2 IKMVIVVRSDIKMGKGKIAAQVAHAAVTLVVSIINsNNlrWkewlneWlHQ-GQPKIIVKVNSLDEIISRAKKAETMNLP 80  Saccharol...
AGI85338            10 MKLVVVMRHDLGMSKGKIASQACHAAVACALDAEK-NC--Peaf-akWeAC-GRRVVILRADSLGELEDVLKRAPGKGVF 84  Candidatu...
WP_015504485        10 YKVVILMRQDVKMSKGKSAAQACHAAVACALASKK-KN--Psaf-aeWdGC-GQKIAVLKVEGERALFEFKAIADQQGIT 84  Candidatu...
licsiro:TALC_00620  10 YKVVILVRQDVKMSKGKTAAQASHAAVACALAAKK-NH--Pref-sgWeTSgGQKIVALKVASLKELFEFKAIADQQGIT 85  Thermopla...
AGN26790             3 YKMVIAMRKDIKLSPGKMAAQAAHAAVSCSFASKK-KN--Plvf-ekWyAE-GQRKIVVKVDTLRELYELKASAESMGVV 77  Candidatu...
Q2NF66               1 MKQVIIMRTDLKMGKGKIAAQACHASLNCYKNADK-----Srl--raWeLS-GQKKVVLKVSSEKELLELNSIVKETDLP 72  Methanosp...
WP_023992694         1 MKQVLVMRADLKMSRGKLAAQACHASLGAYKKADE-----Rsi--reWeLE-GGKKVVVQVKSQEELFQVYELVKAAGIP 72  Methanoba...
WP_012955310         1 MKQVMVVRTDIKMGKGKIAAQCCHAAIGAYKQADK-----Eki--rkWeNE-AYAKVVLKAPTLQDLYNLREIARANGVA 72  Methanobr...
WP_013413630         1 MKQVIVVRDDIKMSKGKLIAQACHASLESFKNAEK-----Nki--kkWeSE-GAKKVVLKVKTLDELLKIYEAVKNSGLP 72  Methanoth...
O27732               1 MKQVIIVRSDLKMGKGKIAAQACHASIGSFKRTEE-----Dki--rkWeLE-GSKKVIVSVNSLDELLEIYRAVKEAGIS 72  Methanoth...
1XTY_D              81 FSIIEDAGKTQLEPGTITCLGIGPAPENLVDSITGDLKLL 120 Saccharolobus solfataricus P2
AGI85338            85 ASLMVDAGLTQVAPMTPTCVGLGPDTDMAIDEVTEGLRLF 124 Candidatus Methanomethylophilus alvus Mx1201
WP_015504485        85 NSIVCDAGRTEVDPGTYTCLGIGPEKQSVIDKITGDLKML 124 Candidatus Methanomethylophilus alvus
licsiro:TALC_00620  86 NAVVCDAGRTEIDPGTITCLGIGPEKQSVIDKITGDLSML 125 Thermoplasmatales archaeon BRNA1
AGN26790            78 SSTVIDAGLTEVPPGTVTCIGFGPGSNEVLDKLTGHLKLM 117 Candidatus Methanomassiliicoccus intestinalis Iss...
Q2NF66              73 HSLITDAGHTQIEPSTRTCLGIGPGSDEEIDKLTGHLKLL 112 Methanosphaera stadtmanae DSM 3091
WP_023992694        73 SFLVTDAGHTELPPSTVTGLGIGPDKDEKIDKITQDLKLL 112 Methanobacterium sp. MB1
WP_012955310        73 YYLVTDAGRTQLPKSTVTVLGLGPDEDDVLDKITGDLKLL 112 Methanobrevibacter ruminantium
WP_013413630        73 HYLVKDAGHTELPPGTITCLGIGPDDDKKIDKITGNLKLL 112 Methanothermus fervidus
O27732              73 NYLVRDAGHTQIPAGTITCLGIGPDDDEKIDKITGDLKLL 112 Methanothermobacter thermautotrophicus str. Delta H
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap