2NV4


Conserved Protein Domain Family
UPF0066

?
pfam01980: UPF0066 
Click on image for an interactive view with Cn3D
Uncharacterized protein family UPF0066
Statistics
?
PSSM-Id: 426543
Aligned: 361 rows
Threshold Bit Score: 119.807
Created: 26-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2NV4_B        18 DAPRQGRFSD-AVSEIAIFDEYADGLHKIENLRHIIVLYWXD-KA---S-RDKLRvvPPGE-TEERGVFTTRSPSRPNPI 90  Archaeoglobus f...
KGO35335      16 DMPIQPKGAAvREGAIEVFDQFAEGLRDLDGFSHIYMLYTFHqAQ---R-TELSV--VPFMdTVARGVFATRSPLRPNHI 89  Desulfobulbus s...
ESQ08075      16 DMPIQPGGGEgVEGTVVIDPDYVEGLQDLEGFSHIYLIYLFHrAR---R-VELTV--VPFMdSEERGVFATRSPLRPSHI 89  Desulfofustis s...
EMS77741      19 DMPIQPKGAAgTQGQIQVDAAFQPGLEDLDGFSHIYLIYSFHkTT---R-TELTV--VPFMdTQPRGVYATRSPLRPNHI 92  Desulfotignum p...
EFK05736      19 DMPIQPKGASaVAGRVIVNEEYIDGLQDLDGFSHIYLLYRFHkAT---R-TEMVV--TPFMdQKTRGVFSTRSPLRPNHI 92  delta proteobac...
ELY71299      23 GMPVQPIGASdAVGTVEVDDAYADGLMDLEGFSHCILLYHFHrAG---DdVSMQV--EPFLdETDRGLFSTRAPQRPNRI 97  Natronobacteriu...
WP_015409478  23 GMPIQPTGADdAAGTVKVDESYADGLQDLDGFTHCILLYHFH-ASgdtA--SLQV--EPFLdDEKRGVFATRAPQRPNQI 97  Natronomonas mo...
WP_004216135  23 GMPIQPVGDAaVEGLVELEEAYADGLQDLDGFTHCILLYHFH-ASddtA--PMKV--EPFLdDEPRGLFATRAPQRPNPI 97  Natrialba magadii
EOD01836      22 DMPIQPSGNKaNKGRLEIDARYVEGLRDLDGFSHIMVIYYFHkSD---K-VKLTV--KPFLdDNTHGVYATRAPVRPNHI 95  Caldisalinibact...
KNF08964      22 NMPIQPIGEKaSQGRIEIFEEFVEGIKDLEEFSHLILIYNFHeAK---K-TKLTV--KPFLdDVERGVFATRSPLRPNHI 95  Gottschalkia pu...
2NV4_B        91 GLCVVEILEVERNRLKVRWLDALDGSPVIDIKKYSPEID 129 Archaeoglobus fulgidus
KGO35335      90 GLSIVEMVKVTANIVIIRGVDVLDGTPLLDIKPYVAAFD 128 Desulfobulbus sp. Tol-SR
ESQ08075      90 GLSIVELVGVAGNILTVRNLDILNSTPLLDIKPYIAAFD 128 Desulfofustis sp. PB-SRB1
EMS77741      93 GISIVRLEKIEGNLLHVLDIDVLNGTPLLDIKPYMEKFD 131 Desulfotignum phosphitoxidans DSM 13687
EFK05736      93 GISIVALTGIEGNNVFVAGIDVLDGTPLLDIKPYIEEFD 131 delta proteobacterium NaphS2
ELY71299      98 GLSVVQIDSVDGREVNVRGIDVVDGTPLVDLKPFVPDFD 136 Natronobacterium gregoryi SP2
WP_015409478  98 GLSVVEIESVRDHEVTVRGIDVVDQTPLLDIKPFVPDFD 136 Natronomonas moolapensis
WP_004216135  98 GLSVVEIESVTDATVTVNSIDVVDQTPLLDIKPFVPDFD 136 Natrialba magadii
EOD01836      96 GLSIVEIDRIEDNNIYVKNIDVLDGTPILDIKPFIPNFD 134 Caldisalinibacter kiritimatiensis
KNF08964      96 GISVVEIEKIEDNNIFIKNIDVLDNTPLLDIKPLVPDFD 134 Gottschalkia purinilytica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap