6SWA,1VW8,3J39,4A18,1VX7,5XY3


Conserved Protein Domain Family
Ribosomal_L14e

?
pfam01929: Ribosomal_L14e 
Click on image for an interactive view with Cn3D
Ribosomal protein L14
This family includes the eukaryotic ribosomal protein L14.
Statistics
?
PSSM-Id: 426516
Aligned: 139 rows
Threshold Bit Score: 62.1325
Created: 26-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6SWA_L        46 RQAMPFKCMQLTDFIL-KFPHSARQKYVRKAWEKADINTKWAATRWAKKIDARERKAKMTDFDRFKVMKAKKMRN 119
EFC41501      49 RHIACTGDIQLVNALA-AVTSASTTEEVVKAAQSSEVQSAYLASPLVKLHLKRVKRQNLTDFDRVKVQILKKKKN 122 Naegleria gruberi
Q383F5        48 RHVQNLKNVEPLKFCV-SISRNCSTKALKEALESKKVLEKYAATKSAVRIAAKKAFAESTDFERYQLRVAKRSRA 121 Trypanosoma brucei
CAM45213      48 RHVQNLKNVEPLKYCV-SVGRNCSAKALKDALDSSKVLEKYAKTRTAARVEAKKACAASTDFERYQLRVARRSRA 121 Leishmania brazilien...
Q8ILE8        66 RMVIPLKRLKLLKERI-KINKNCKSGFLRKTVNSTKVLEEFNNSKLGKKMIIKKKRDEATDFERFQVYFAKRELK 139 Plasmodium falciparu...
XP_002260706  66 RMVIPLKRLKLLKERI-KINKNCKTGFLHKTIKSTNIIGEFKKSNLGKKLAIKKKRDLATDYERFQIYHAKRELK 139 Plasmodium knowlesi ...
Q7RMK6        49 KTIMPIKRLKLLKQRV-KINANSRTGLLRKEVNKSKVLEAFSKSNLGKKMMIKQKRDLATDYERFQIYYANKQLK 122 Plasmodium yoelii yo...
XP_649601     49 RQVVNLNTISLTSFVVnKVTRGMTHKKLCLRFTQDAIIKRFNKTATGKAIEKRILREKMTDFDKFQVSIINRKIN 123 Entamoeba histolytic...
XP_015783871  47 RQPLSFQKMKLTKYILkDVHPTIGDKALSLKLKESDFVDQFNKSKTGQNLKNKEKRTKMTDFDRFKLQKTKQKMN 121 two-spotted spider mite
1VX7_N        66 RMVIPLKRLKLLKERI-KINKNCKSGFLRKTVNSTKVLEEFNNSKLGKKMIIKKKRDEATDFERFQVYFAKRElk 139 Plasmodium falciparu...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap