1G61


Conserved Protein Domain Family
eIF-6

?
pfam01912: eIF-6 
Click on image for an interactive view with Cn3D
eIF-6 family
This family includes eukaryotic translation initiation factor 6 as well as presumed archaebacterial homologs.
Statistics
?
PSSM-Id: 460381
Aligned: 132 rows
Threshold Bit Score: 106.749
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1G61_B             7 KYFSGIPTIGVLALTTEEITLLPIFlDKDDVNEVSEVLETkCLQTNIGGSSLVGSLSVANKYGLLLPKIVEDEELDRIKN 86  Methanocald...
WP_014052439       4 AAFAGSSYVGVFAMATDDCLLIRPDtEEEVVEGMSDELGVpAIETTVAGSNTVGALATGNENGLLVSGRVTDRERDRIED 83  halophilic ...
WP_006055501       4 ASFAGSAYVGVFACVTDHVLLVRPDaEDDVVDAMTAELDVpAVRTTVGGSGTVGALAMGNDNGILVSARATEREKETIED 83  Halogeometr...
Q18EU8             4 ASFAGSPYVGVFARATDDVLLLRSDvDDDTADAMAAELDIpAVATTIGGSGTVGALATGNENGILVTSNVTMREKEAIET 83  Haloquadrat...
KHU:HacjB3_01415   4 TAFFGSSSVGVFARATDDALLVRNDvEDDLREELEDELDVpSLPTTIGGSSTVGALSVGNENGLLVSSRITETEREAIGT 83 
CCQ35525           4 ASLSGSAYVGVFGRATDDCLLVRPDiEASLLEAFETELDVpAVPTTVAGSGTVGALAVGNENGLLVSERVTDRERDRIEG 83 
WP_049938268       4 AAFIGSPYVGVFARATDDCVLLRQDlDDDLTADVADELGVpAVETTIGGSTTVGSLVAGNGNGLLVSGRVRQRELDRIDD 83  Halobacteri...
WP_020445956       4 ASFSGSSYVGVFARAAAGHLLVRPDvDVSLQQSIADELGLePLPTTVGGSGTVGSLAVGNDNGILVSSRALDRELDRIRD 83  Salinarchae...
WP_013878826       4 LAFAGSAYVGVFARATDSCVLVRQDvDDDVVADLSDELEVpAIETTVGGSSTVGALATGNENGLLVSSRVLEYERERLEE 83  Halopiger x...
jgi:Halru_0348     4 ASFAGSAYVGVFACATDSLLLVRPDaDDDTVVAIADELGVtAVPTTVSGSGTVGVLATGNENGLLVSNRVLEYERERLAE 83 
1G61_B            87 FLKennLDLnvEIIKSKNTALGNLILTNDKGALISPELKD-FKKDIEDSLNVEVEIGTIAELPTVGSNAVVTNKGCLTHP 165 Methanocald...
WP_014052439      84 ETG---LPV--HGLPGRINAAGNVVLANDSGAYAHPELTNdQISVVEEALAVPVERGSLGDVRTVGTAAAATNTGVLCQP 158 halophilic ...
WP_006055501      84 VAG---VPV--TELPGRINAAGNVVLANDSGAYVHPDLSDeALAVVEDALDVPAERGDLADVRTAGTAAVATNDGVLCHP 158 Halogeometr...
Q18EU8            84 TAS---VSV--TELPGRINAAGNVILANDYGAYVHPDLSTeAVESIESALNVPVARGKLADVRTVGTAAVATNRGVLCHP 158 Haloquadrat...
KHU:HacjB3_01415  84 VTD---LPI--TELPGRINAAGNVVLANDSGAYVHPDLSReAVRAVEDGLGVPVERGELAGLRTVGTAAVATNDGVLCHP 158
CCQ35525          84 ETD---LSV--GELPGRINAAGNVVLANDRGALAHPDLSRkAVRAVGDTLDVPVERGEIAGVRTVGTAAVVTENGVLCHP 158
WP_049938268      84 QVG---VTV--GELPGRVNAAGNVVVANDNGAYVHSELTRdAVEAVEDALDVPVTRGRLAGVNTVGTAAVATNDGVLCHP 158 Halobacteri...
WP_020445956      84 AVS---VPV--AELPGRINAAGNVVLANDTGAYVHRELGDeAVEVIEETLGVPVDRGDVASVRTVGTAAVANDRGVLCHP 158 Salinarchae...
WP_013878826      84 AVD---VPI--AELPGNVNAAGNVVLANDYGAYVHPDLTReAIQIIEDTLEVPVERGDLAGVRTVGTAAVATNTGVLCHP 158 Halopiger x...
jgi:Halru_0348    84 ATD---VPI--GTLPGEINAAGTVVLANDHGAYVHPDLSReAVQAVEDTLDVPVERGDLAGVRTVGTAAVATNEGVLCHP 158
1G61_B           166 LVEDDELEFLKSLFKVEyIGKGTANKGTTSVGACIIANSKGA 207 Methanocaldococcus jannaschii
WP_014052439     159 QSREPELEALEALLDAY-ADVGTINYGGPLVGSGIVANDEGY 199 halophilic archaeon DL31
WP_006055501     159 KSREPELEALEELLDVR-ADIGTVNYGAPLVGSGLVANEFGy 199 Halogeometricum borinquense
Q18EU8           159 KAREPELEAIEDHLDVR-ADIGTVNYGAPLVGSGIVAGQTGY 199 Haloquadratum walsbyi DSM 16790
KHU:HacjB3_01415 159 KATDGELDFLEEHLGVY-ADIGTINYGAPLVGAGLVANEFGy 199
CCQ35525         159 KTTDETLDFLEDLFGVY-ADIGTINYGGPLVGSGLIANASGY 199
WP_049938268     159 KSTDDELDAIEDALGVH-ADIGTINYGAPLVGSGLVANENGY 199 Halobacterium sp. DL1
WP_020445956     159 KATDEQLDHLAEHLDVH-ADIGTINYGAPLVGSGLIASEDGY 199 Salinarchaeum sp. Harcht-Bsk1
WP_013878826     159 KATDEELDFLEEALDVR-ADVGTVNYGAPLVGSGLIANEAGY 199 Halopiger xanaduensis
jgi:Halru_0348   159 KSTDEELDRLEDVLDVR-ADVGTINYGAPLVGSGLLATDAGY 199
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap