3J39,6AZ3,5XY3,4A18,1S72,3J21


Conserved Protein Domain Family
Ribosomal_L37e

?
pfam01907: Ribosomal_L37e 
Ribosomal protein L37e
This family includes ribosomal protein L37 from eukaryotes and archaebacteria. The family contains many conserved cysteines and histidines suggesting that this protein may bind to zinc.
Statistics
?
PSSM-Id: 426505
Aligned: 86 rows
Threshold Bit Score: 57.5846
Created: 26-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3J39_j           2 TKGTSSFGKR-HNKTHTLCRRCGRSSYHIQKSTCAQCGY-PAAKLRSYNWSVKAK 54 
jgi:Metev_0184   2 SKGTESFGKRqKR-THTKCRRCGSMSFNVRDKECKSCGFgKTKRMRSYNWNKn-- 53  Methanohalobium evestigatum Z-7303
Q12U31           2 SKGTPSMGKRqKR-THAKCRRCGSVSLNIHTKQCTSCGFgRTSRMRSYQWQRKCK 55  Methanococcoides burtonii DSM 6242
bsuwp:MCON_1205  2 TKGTPSMGKRhKS-SHIRCRRCGSISFNFKRKVCVQCGFgNSAKLRSHKWMRKAD 55  Methanothrix soehngenii GP6
A0B5Q5           2 SKGTPSMGKChKR-THVRCRRCGRLSYNFNRKTCVACGFgRSKRLRSYKWMRKAG 55  Methanothrix thermoacetophila PT
AGI86085         2 GAGTAAQGRHnKFKTHIPCRRCGKRSYNVRKGVCASCGYgKTARIRSYTWAKlre 56  Candidatus Methanomethylophilus alvus ...
AGN25731         2 GKGTPSMGKRsSGKSHIPCRRCGRSAYNIVKGTCASCGYgKTTRIRSYSWAKqh- 55  Candidatus Methanomassiliicoccus intes...
jgi:Halxa_2471   3 GAGTPSQGKKnKT-THVKCRRCGEKSYHVKKKECSSCGFgKSAKRRDYEWQSKAG 56  Halopiger xanaduensis SH-6
jgi:Halru_1898   3 GSGTPSQGKKnKT-VHVKCRRCGEASYHTKKERCSACGFgKSASRRDYAWEGKAG 56  Halovivax ruber XH-70
1S72_1           3 GAGTPSQGKK-NTTTHTKCRRCGEKSYHTKKKVCSSCGFgKSAKRRDYEWQSKAg 56  Haloarcula marismortui
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap