6M6G,7BR7


Conserved Protein Domain Family
Herpes_V23

?
pfam01802: Herpes_V23 
Click on image for an interactive view with Cn3D
Herpesvirus VP23 like capsid protein
This family consist of various capsid proteins from members of the herpesviridae. The capsid protein VP23 in herpes simplex virus forms a triplex together with VP19C these fit between and link together adjacent capsomers as formed by VP5 and VP26. VP3 along with the scaffolding proteins helps to form normal capsids by defining the curvature of the shell and size of the particle.
Statistics
?
PSSM-Id: 460337
Aligned: 11 rows
Threshold Bit Score: 263.864
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6M6G_K   7 EADIAIPSGISRPDAAALQRCEGRVVFLPTIRRQLALADVAHESFVSGGVSPDTLGLLLAYRRRFPAVITRVLPTRIVAC 86  Human alphaherpesvirus 2
F5HGN8   6 SIVVNFTSRLFADELAALQSKIGSVLPLGDCHRLQNIQALGLGCVCSRETSPDYIQIMQYLSKCTLAVLEEVRPDSLRLT 85  Human herpesvirus 8 s...
Q01008   6 TIIVSLTSRLFADEITKLQKKIGSILPLQDPHKLQSLDTLGLNAVCSRDVFPDYVHMFSYLSKCTLAILEEVNPDNLILT 85  Herpesvirus saimiri (...
Q66629   6 RIVVTLTSRLYADEISKLQERVGSVVPLKDSHRLQNLNSVGMYSVYMRNVAPDFVAMFSYLSEATLAILDEVTPDTLVFS 85  Equid herpesvirus typ...
O36376   6 KIVVSCTSRLFTDEVCKLQEKVGCIVPLRDSHGSQNLQTVGLKPALGIDLGSDYVLMCNYLSTCTLAILEEVTTDSLVLT 85  Alcelaphine herpesvir...
Q9QJ27   3 TVYCTFDHKLSLSDISTLCKLMNIVIPIPAHHHLIGSGNLGLYPIVSSN--KDYVHIRNVLRTMVVTILQKVEGNQLVLR 80  Human herpesvirus 6 s...
F5HIN9   7 NIFCTFDHKLSIADVGKLTKLVAAVVPIPQRLHLIKHYQLGLHQFVDHT--RGYVRLRGLLRNMTLTLMRRVEGNQILLH 84  Human herpesvirus 5 s...
Q6UDI3  10 EVKITLPGNLTRDEEDRLRCLTGTILMAPSLRRCLFLHDVDRNSYYVHGSEPDYATSLAAYRRRFPLLVTAVGRQELSAV 89  Psittacid herpesvirus...
Q9E6P9   8 iVEIELPCKLSTCDANLLQRCEGRVLFLPFVRARVLLKDVDYKSFYIAGTEPDTLSLLSTFKTRFAAVITRALPGRMSAV 87  Marek's disease herpe...
P09291   6 EIEVLLPGELSPAETSALQKCEGKIITFSTLRHRASLVDIALSSYYINGAPPDTLSLLEAYRMRFAAVITRVIPGKLLAH 85  Human herpesvirus 3 s...
7BR7_6   4 KVVVSLSSRLYTDEIAKMQQRIGCILPLASTHGTQNVQGLGLGQVYSLETVPDYVSMYNYLSDCTLAVLDEVSVDSLILT 83  Epstein-Barr virus (s...
6M6G_K  87 PVDLGLThagtVNLRNT-SP-VDLCNGDPVSLVPPVF-EGQaTDVRLESLDLTLRFPVPLPTPLAREIVARLVARGI--- 160 Human alphaherpesvirus 2
F5HGN8  86 RMDPSDN----LQIKNVyAPfFQWDSNTQLAVLPPFF-SRKdSTIVLESNGFDLVFPMVVPQQLGHAILQQLLVYHIysk 160 Human herpesvirus 8 s...
Q01008  86 RLDPSET----YQIKNVyEPmFQWDGFSNLTVIPPVF-GRQqATVTLESNGFDLVFPSVVPSDLAQAIIGKLLLYNLysr 160 Herpesvirus saimiri (...
Q66629  86 RLDHSQN----YELKNVyYPsFAWHSHTLLTVVPPVF-GREaATVALESNGFEIVFPVVMPHALAQAVLQKLMLYNIyar 160 Equid herpesvirus typ...
O36376  86 KISRNGT----YQIKNKyHPfFQWDSNIQVCVMPPLF-DQEsNSVDLQSNNFTLLLPIVVPCEVAHEALQKVLTYNIylr 160 Alcelaphine herpesvir...
Q9QJ27  81 KPMTGQQ----YAIKNT-GP-FPWEKGDTLTLIPPL--STHsEEKLLKLGDWELTVPLVVPTAIAAEINIRLLCIGLiav 152 Human herpesvirus 6 s...
F5HIN9  85 VPTHGLL----YTVLNT-GP-VTWEKGDALCVLPPLFhGPLaRENLLTLGQWELVLPWIVPMPLALEINQRLLIMGLfsl 158 Human herpesvirus 5 s...
Q6UDI3  90 SLSIGCPk--gLNFRNT-GP-FQLLNGSNVSLIPPIG-GRW--RVELLSCGSVIEPAMTIPTEVGSELLGKILA-GMtye 161 Psittacid herpesvirus...
Q9E6P9  88 VLGMGSIpn-gLALQNT-GP-FDLCNGDTVCLMPPIF-PNVcCRIRLESIDTELLFPVTVPTRLANEILAKTLSRAIea- 162 Marek's disease herpe...
P09291  86 AIGVGTPtp-gLFIQNT-SP-VDLCNGDYICLLPPVF-GSA-DSIRLDSVGLEIVFPLTIPQTLMREIIAKVVARAVert 160 Human herpesvirus 3 s...
7BR7_6  84 KIVPGQT----YAIKNKyQPfFQWHGTGSLSVMPPVF-GREhATVKLESNDVDIVFPMVLPTPIAEEVLQKILLFNVysr 158 Epstein-Barr virus (s...
6M6G_K 161 ---RDLNPDPRTPGElpdlNVLYYNGARLSLVADVQQLASVNT----------ELRSLVLNMvysitegtTLILTLIPRL 227 Human alphaherpesvirus 2
F5HGN8 161 -isAGAPDDVNMAELdlytTNVSFMGRTYRLDVDNTDPRTALR----------VLDDLSMYL--------CILSALVPRG 221 Human herpesvirus 8 s...
Q01008 161 -lvESDP-EINIEEVnmytTNVTHMGRHYVLDINHNNPNEALK----------SLDDLAVYT--------CILSALIPRA 220 Herpesvirus saimiri (...
Q66629 161 -lsDANVGDVNMDHVrfhaTTLHHMGRAYTLHIDQANPGGMLG----------LLDNLAIYL--------AIISALLPNS 221 Equid herpesvirus typ...
O36376 161 -vtQAEPNAARMADVlaqtNYVTYLGNHYSLNLEGMESLGALA----------FLDNLATYL--------CIMVGLLPRA 221 Alcelaphine herpesvir...
Q9QJ27 153 -hrEYN----EMQTIidelCSIQYRDVLIKLP-DIVNDKQSMY----------SMKTACISL--------SMITAMAPDI 208 Human herpesvirus 6 s...
F5HIN9 159 -drSYE----EVKAAvqqlQTITFRDATFTIP-DPVIDQHLLI----------DMKTACLSM--------SMVANLASEL 214 Human herpesvirus 5 s...
Q6UDI3 162 fcaRNQIPADRPAEV-------------YRVACDNKALDLTQAirggdsdlqdTMKTLFASVlfamnegvLQVMTLMPAL 228 Psittacid herpesvirus...
Q9E6P9 163 -igRGQMPPPTSRES----ETIMYNGRSYTISPTLHSLDAAES----------TVRTLLLNMifainegnMILYTMIPTL 227 Marek's disease herpe...
P09291 161 aagAQILPHEVLRGA----DVICYNGRRYELETNLQHRDGSDA----------AIRTLVLNLmfsinegcLLLLALIPTL 226 Human herpesvirus 3 s...
7BR7_6 159 -vvMQAPGNADMLDVhmhlGSVSYLGHHYELALPEVPGPLGLA----------LLDNLSLYF--------CIMVTLLPRA 219 Epstein-Barr virus (s...
6M6G_K 228 LALsaqdgYVNALLQmqsvtreaaqlihpeapmlmQD---GERRLPLYEAL----------------------------- 275 Human alphaherpesvirus 2
F5HGN8 222 CLR-----LLTALVR--------------------HD---RHPLTEVFEGVvpdevtridld---------qlsvpddit 264 Human herpesvirus 8 s...
Q01008 221 CLR-----VLTILMR--------------------HD---QHELLDVFRGIvprevyeidan---------alsigddit 263 Herpesvirus saimiri (...
Q66629 222 LAR-----LLPAIMR--------------------HE---QHELLNIFAGVappddggdf-------------nieddmq 260 Equid herpesvirus typ...
O36376 222 CVR-----LLTTLLR--------------------HG---ENELLNVFRRMipdefnaaaanl-------nadtvypdmt 266 Alcelaphine herpesvir...
Q9QJ27 209 VRT-----YIDRLTL--------------------ED---HSMLLIKCQELlskrttlstqrcgq----lhatdikdelk 256 Human herpesvirus 6 s...
F5HIN9 215 TMT-----YVRKLAL--------------------ED---SSMLLVKCQELlmrldrersvgeprtparpqhvspddeia 266 Human herpesvirus 5 s...
Q6UDI3 229 LAGgntnpFLNALLQmqsatrlsaq-ifnpptlpvHDptgGARRYNVFDAF----------------------------- 278 Psittacid herpesvirus...
Q9E6P9 228 LTLgasdgYINALVGletatravgqliripnppplQD---AWRRYPVYEAL----------------------------- 275 Marek's disease herpe...
P09291 227 LVQgahdgYVNLLIQtancvretgqlinippmpriQD---GHRRFPIYETI----------------------------- 274 Human herpesvirus 3 s...
7BR7_6 220 SMR-----LVRGLIR--------------------HE---HHDLLNLFQEMvpdeiaridld---------dlsvaddls 262 Epstein-Barr virus (s...
6M6G_K 276 --VAWLAHAGQLGDILALAPAVRVCTFDGAAVVQSGD 310 Human alphaherpesvirus 2
F5HGN8 265 rmRVMFSYLQSLSSIFNLGPRLHVYAYSAETLAASCW 301 Human herpesvirus 8 strain GK18
Q01008 264 rmTTFITYLQSLSSIFNLGAKLHLSSYASETQTATCW 300 Herpesvirus saimiri (strain 11)
Q66629 261 kmESFMAYMQSVSSIFNLGPKLRLGQYSSETQSGTAW 297 Equid herpesvirus type 2 strain 86/87
O36376 267 kiGLLITYLQTLGSIFNLSPRLQVSTYTPENLSATCW 303 Alcelaphine herpesvirus 1 strain C500
Q9QJ27 257 kiKSVLTMIDQINSLTNEKTYFVVCDVSADNRMATCI 293 Human herpesvirus 6 strain Z29
F5HIN9 267 rlSALFVMLRQLDDLIREQVVFTVCDVSPDNKSATCI 303 Human herpesvirus 5 strain Merlin
Q6UDI3 279 --ASWLTMSHRLGELFHMKPALKVVMFYSDVSAIDEG 313 Psittacid herpesvirus 1 Amazon parrot/1997
Q9E6P9 276 --SAWITMTLNLGNVLSLHPLLKVCTFDGPANIKAGD 310 Marek's disease herpesvirus type 1 strain MD5
P09291 275 --SSWISTSSRLGDTLGTRAILRVCVFDGPSTVHPGD 309 Human herpesvirus 3 strain Dumas
7BR7_6 263 rmRVMMTYLQSLASLFNLGPRLATAAYSQETLTATCW 299 Epstein-Barr virus (strain B95-8)
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap