5YS9,5Y9D,5K3H,5K3J


Conserved Protein Domain Family
ACOX

?
pfam01756: ACOX 
Click on image for an interactive view with Cn3D
Acyl-CoA oxidase
This is a family of Acyl-CoA oxidases EC:1.3.3.6. Acyl-coA oxidase converts acyl-CoA into trans-2- enoyl-CoA.
Statistics
?
PSSM-Id: 460314
Aligned: 234 rows
Threshold Bit Score: 119.574
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5YS9_B       506 DPKVLIEAWEKVANGAIQRATDKFVELTKGGLSpDQAFEELSQQRFQCAKIHTRKHLVTAF---YERINa------S--A 574 Yarrowia lipoly...
XP_002904746 517 NATLLRDALDVYTGRQVLQVAAKLAAAN--GKTeAERMNSCQVDLVEIARVHVFYNVASAF---LQHIEeieieasG--D 589
XP_002618997 510 EPKKILFAIEVALVRACIRADQILESKN-------GDTDFIGAELVTLSKLLAHFFLLKAF---LDKIEa------Tk-D 572
Q6BVP3       508 DTRKVLHAVEVAIIRASNQALTTLDAHG-------EDWDFIGANLVQLSKLLAHFFLLKAF---LDKVDs------I--E 569 Debaryomyces ha...
XP_006687988 508 DTSKLLQAIQVVLIRGSYQCLKALEANG-------EDWDYIGADLVTLSKLLAHFFLLKAF---LDKIDs-----mSspD 572
XP_001487816 530 SLEQVLKAVEVALIRTANQALADLDKNG-------EDWDYIGARLVELSKMLAHFFMLKSF---LEKFNt------L--E 591
EMG50214     474 DPAKLTKAFDHALSGLARDIGKVAk---------TQGYDVTGPSLVLVSKLNAHRFLIDGF---FKRIT-------K--T 532
EER33903     473 DPAKLVKAFDHALSGLARDIGAVAd---------EKGFDITGPSLVLVSKLNAHRFLIDGF---FKRI------------ 528
EPB84908     512 DFALIEEALHVILVKRLNSIQQAL----NDGAT----HNDLLLESVRVAELHCAAFLFSVNarqFASVSd------Sd-M 576
EPB84677     525 DFALVSEALNTILVKRLYSIQTALKNGA--------TQNDVLLDSVRVAELHCAAFIFSVC---AEKYGqpi-gtaG--I 590
5YS9_B       575 KADVKPYLINLANLFTLWSI-EEDSGLFLREGFLQPKDIDQVT-ELVNHYCKEVRDQVAGYTDAFGLSDWFINAPIGNYD 652 Yarrowia lipoly...
XP_002904746 590 NETLLPALEALCQVYICQEL-DRGAAFLLKEKFMSPFQSNLVR-ARLMESCARVRDDAVALVDAFMLTNTVLNSSVGRAD 667
XP_002618997 573 QPNLVAVLDLLAQLYGATVIlEGFSGTFLTFSVTTTEAIAHNStEHIAELCSKIRPHVIPLTDSFMMSDMMINAPIGYYD 652
Q6BVP3       570 EKELVPVLDKLAQLYSATIIlEEFSGIFLTYSVVSTESISILTdQHIPKLCKDLRPHVIPLTDSFQLSDMMINSSLGSYN 649 Debaryomyces ha...
XP_006687988 573 EKVLVEILDKLAQLYSATIVlEAFSGFFLSYSVISADAMTTLTtGRIQELCSQIRPHVIPLTDAFQLSDMMINSSLGGYD 652
XP_001487816 592 EGPMKLVLKQLAQLYSSSVIlEGFSGIFLTFKVLDSDTVSYLSsEYIQKLCADLRPHVIPLTDAFNLSDMIINSSLGNYD 671
EMG50214     533 PD-FTEVLKPLGFLYADWII-NTFSSVFLSYGVITADVIKKISsEHFPALAKQVRPNVVGLTDAFNLSDMLTNAAIGTED 610
EER33903     529 TPEWSDILKPLGYLYADWIL-TNFGATFLSYGIISPEVSRKISsEHFPSMCAKVRPNVVGLTDGFNLTDMMVNAAIGRYD 607
EPB84908     577 DPSVQLIMRQMTALWGLHILrVYGDQGYMEG-FLSPKQLKDIE-KEYLELCKSMRYEVIGLTDGFGLPDFVLKAPIAKYD 654
EPB84677     591 EPSVLAIMKKLTALWGLHVLhIYGDQGFKEG-YLSPDQINSIE-KTYLEHCKSLRKQVIGLTDAFGFPDFVLKAPIAKYD 668
5YS9_B       653 GDVYKHYFAKVNQqNPAQ-NPrPPYYESTLRPFLF 686 Yarrowia lipolytica CLIB122
XP_002904746 668 GSIYEGALAAVRHr----mGPt-PYFTSAIKPIFD 697
XP_002618997 653 GNIYENYMRTVQEnNPAK-NH-KAPYSAALEAMLN 685
Q6BVP3       650 GDIYENYFKIVKEaNP-P-FNhKAPYSTDLEAMLN 682 Debaryomyces hansenii
XP_006687988 653 GNFYEEYFKIVKDnNPAP-GSfHAPYTASIKAMLQ 686
XP_001487816 672 GNVYENFFKIVKDrNPAP-GSyTAPYEEEFRAHLN 705
EMG50214     611 GNVYETYFNTVKTlNPPI-NT-KAPYSDALEAMLN 643
EER33903     608 GNVYDNYFETVKSlNPPEnTK--APYSKALEDMLN 640
EPB84908     655 GNIYQAYFETLLQ-APGS-TGvAPYHAKLIKPLTE 687
EPB84677     669 GDIYQTYLETLLA-APRS-TGvAPYHAKYIKPLTE 701
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap