6KAC,4PJ0


Conserved Protein Domain Family
Ycf9

?
pfam01737: Ycf9 
YCF9
This family consists of the hypothetical protein product of the YCF9 gene from chloroplasts and cyanobacteria. These proteins have no known function.
Statistics
?
PSSM-Id: 426402
Aligned: 34 rows
Threshold Bit Score: 34.5689
Created: 26-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6KAC_z        6 QVALLALIFVSFALVVGVPVVFATPNGWTDNKGAVFSGLSLWLLLVFVVGILNSFV 61  Chlamydomonas reinhardtii
Q2PMU0        6 QLAVFALIAISFILLISVPVVFASPEGWSNNKNVVFSGTSLWIGLVFLVGILNSLI 61  soybean
1_pfamImport  1 -VVVFALVATSSVLVISVPLVFASPDGWSNNKDVVFSSTSLWIGLVFLIAILNSLI 55 
2_pfamImport  3 QIADFALIAASSVLVISVPLCFL---GWSNNTNVVFSSTSLWIGLVFLIAILNSLI 55 
EFJ05009      5 QSAVFASIAIPFIPVIGVPVVLASPDGWSSGKNVVFSGAPLRIGSVLCVGILNSFV 60  Selaginella moellendorffii
Q6YXP0        6 QFAVFALIAISFLLVIGVPVVLASPDGWSSSKNVVFSGASLWVGLVFLVGVLNSFI 61  Physcomitrella patens
AIH00164      6 QLALFAFIVVSFLLVVGVPVVLATPEGWSENKGTVFSGIGIWFLLVFLVGILNSFV 61  Chlorella variabilis
A0T0L7        3 TALTALLVLISLGLIVTVPVALATPGEWENSKSDFTKGFQAWVALVLVIAAADGVA 58  Phaeodactylum tricornutum CCAP 1055/1
B0C0S7        6 QLLIAAFVALSFAMIIGVPVVFSTGDASDDANKLIWGGAAAWVVLLFVAALASIVV 61  Acaryochloris marina MBIC11017
Q2JJZ7        6 QIALLVLVLYSLLLVVAVPVLYSSASDWSRAKNVILVGSLLWVLMVIGVGVLSFLk 61  Synechococcus sp. JA-2-3B'a(2-13)
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap