6OXC


Conserved Protein Domain Family
MM_CoA_mutase

?
pfam01642: MM_CoA_mutase 
Click on image for an interactive view with Cn3D
Methylmalonyl-CoA mutase
The enzyme methylmalonyl-CoA mutase is a member of a class of enzymes that uses coenzyme B12 (adenosylcobalamin) as a cofactor. The enzyme induces the formation of an adenosyl radical from the cofactor. This radical then initiates a free-radical rearrangement of its substrate, succinyl-CoA, to methylmalonyl-CoA.
Statistics
?
PSSM-Id: 460279
Aligned: 271 rows
Threshold Bit Score: 376.79
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6OXC_B           51 ADGFAIRALYTAFDe---lPEppLPGQWPFVRGGDPLR-DVHSGWKVAEAFPanGATAD-TNAAVLAALGEGVSALLI-- 123 Mycobacteriu...
WP_014561285     47 YEGIELKPIYTSDDiknipFLnnYPGFENFVRGTKASG-YHSSEWEIAQEYS--YALPEeLNETLRYDLQRGLNSINInl 123 Ignavibacter...
WP_013042549     41 PEGIELEPIFWRDVldnlpASetQPGFDGYLRGTSAAG-YNQEPWEVAQELP--YGTPKeFNDAAREDLMRGQNALNIil 117 Coraliomarga...
WP_009513003     51 PEGIALQPLYTRADiagipGLdaAPGSAPFLRGTRARG-YKERPWEIAQEIL--AATPAgYNATLLDALNHGQDSVPLtt 127 Opitutaceae ...
WP_012376113     44 FEGISLQPLYTRADlagvpHLgtAPGAAPFLRGTRKQG-YKDKIWRIAQEST--ASDAEaFNTAIRQDLAAGQDAVVLrp 120 Opitutus terrae
jgi:RoseRS_0544  52 YENILLQPIYNIEDiaglpQVnsLPGFEPFVRSTRALG-YVIARWEVCQELP--YPLPReVNEAARSDLSRGLTSLNLpl 128
BAH43664         40 HEGIVRQPIYRYEDvktlpHLeaLPGEAPFHRGNQQPGeHKEHKWQVCQEIS--ATSAKtFNQAAVDDLARGQTMLHLiv 117
WP_011735208     53 YEGLTINPIYSADDikglpHLesRPGYVPYVRSTHVGG-YLEKPWFICQELL--VSLPEeFNSEALFDTSRGQTMLNLvl 129 Pelobacter p...
WP_012609369     51 YEDIDLQPMYWQHEikdlpHIdtMPGSAPFVRGTKADG-FLINPWNICQAIS--CSMPEeFNKAAVHDLERGQTGLQVvl 127 Desulfatibac...
WP_012258368     52 FENILLQPIYNASDiadlpHLgsLPGFAPFVRDTRILG-PVRERWQVAQELP--YPTATeVNQAAQADLPRGLTTLNVpl 128 Chloroflexus...
6OXC_B          124 ----------------RVGESGVAPDR---LTALLSGVYLNLAPVILDAGADYRPACDVMLALVAQLDpGQRDTLSIDLG 184 Mycobacteriu...
WP_014561285    124 dlptqlgidadqskpgEVGKGGLSISGirkMQVLFDNIDLTEHPIHINAGFSALPFTLLFAAFTRELR-LSLMNLKGSIT 202 Ignavibacter...
WP_013042549    118 diatlkgidpdsagdyEVGACGLSIACledVKTAFKEIVPDAVSFHIRTGCAGLSVGAMFFAWLKQQG-ADLKAVKGSLG 196 Coraliomarga...
WP_009513003    128 s--------------dacPCCGLAINSpadLAAALAGVSLAHIPVHLAPGADATRLAALYLACAADQG-VAPASLTGSLA 192 Opitutaceae ...
WP_012376113    121 dlasragrdpdaarpeELGVDGVSLATlddLNTALKDVDLTAVPVNVQTGADALPIAALYLQHAKIRG-VDWTRLTGAVS 199 Opitutus terrae
jgi:RoseRS_0544 129 dqatlqgldpdaapmaLVGAGGVSLATvddAVTLLEGVTLDRTPLLVAAGANAVPVAALILAAAERSG-VGFDRIGGCIG 207
BAH43664        118 dqatlagldpdealpdTIGHKGVSVFCredIEQAFQGVKLSEVPLYMNTGALGLPILSILLAHVEATD-QKASELRGCIG 196
WP_011735208    130 drptkkgldpaeaetgEVGKRGLSLASvsdLKRAFKGLDLASLPLLCNTGATALPLTALLAAALESDG-VPLKRFKGCVG 208 Pelobacter p...
WP_012609369    128 dpavklgqdpgqakaeDVGAMGLSAACagdFAKALAGVDTANIPMFVNAGATALPIASLMAAGQLVSG-KFAASLAGCVG 206 Desulfatibac...
WP_012258368    129 dqatrqgidpdaaapaQVGAGGMSLATlddARRLFDQLDLARIPLLIQTGALSLPVAGLLLAAAAERG-LSSDRWQGTLA 207 Chloroflexus...
6OXC_B          185 ADPLTASLRD-----RPAPPIEEVVAVASRAAGERG-LRAITVDGPAFHNLGATAATELAATVAAAVAYLRVLTesGLVV 258 Mycobacteriu...
WP_014561285    203 SDPYDFLLKQgylpySLKQIFDEIKFSTQLMIRSNSpIRTIGVSGLNYNNAGANAVQELAFAFATAVEYLEEMLnrGLAI 282 Ignavibacter...
WP_013042549    197 MDPIAVQAAAgalpvKLSELLDEQATLARYCAENAPgVKAITVSTLPYHQAGGSSVDELGAALATGAYYIEQMLerGLTV 276 Coraliomarga...
WP_009513003    193 ADPLAHWAAAgslpsPLASLHDALATWTNDASRKAPaLKTIGVNAAIWGNAGGNAVQELAGAISAAAEYLRELLkrGVSL 272 Opitutaceae ...
WP_012376113    200 ADPLGEWLARgelptTLEELYDNLAAWTKWAGNHAPaLHTIGVNAAMWGEAGGTATQELAFALAAAAEYLRALYrhGLRS 279 Opitutus terrae
jgi:RoseRS_0544 208 ADPLGALAVQgslplSLERSYDLMAQWTAWAHVHAPlLRTILVATHVYHNGGASVVQDLACALATGVAYIRAMQarGLDV 287
BAH43664        197 QDPVAVLLTEgklpcSLQTAYNTMASVTKWAKDQAPaLKTILVQSNPYQDGGGNAVTELAFSLATGVDYLQAMLerGLSI 276
WP_011735208    209 CDPLAELVNEgalriALPVAYDAMCQVTSWAIQNMPgLETIFIQGHPYHDAGASSTEEVAFALATAAEYLREMLtrGLAV 288 Pelobacter p...
WP_012609369    207 ADPLGELAAKgaipiSLNAAYDSMTALLMWAKSNARhVRTIIASGSPYHDAGASATQELAFAVATAVEYVRAMQdrRVEF 286 Desulfatibac...
WP_012258368    208 ADPLGNLAAEgslpaSLERCYDLLAEWTRWAMTNAPhLRTIMVSSYVYHNSGASIGQEMGCALATGVAYLRAMQerGLDV 287 Chloroflexus...
6OXC_B          259 SDALRQISFRLAADDDQFMTLAKMRALRQLWARVAEVVGDP-G-GGAAVVHAETSLPMMTQRDPWVNMLRCTLAAFGAGV 336 Mycobacteriu...
WP_014561285    283 EEVVKRFKFTFGISSFYFMEIAKFRAARILWNNILKQYNVSeE-NRKIYIHGKTSQYNQTIIDPYVNMLRTTTEAFSAVV 361 Ignavibacter...
WP_013042549    277 DEAAKQIRFSFAIGPNFFMEIAKIRAARVLWAKVVAAFGGStD-AQKISIHARTGLYNKTQKDPYVNMLRTTTEALSGVI 355 Coraliomarga...
WP_009513003    273 ETAATRIRFTFAIGPQFFTEIAKFRAFRPLWTRVLAAFGAApGlAARAALHATTSWWNKTLLDPNVNMLRVTTEALSAVL 352 Opitutaceae ...
WP_012376113    280 ESVATRMSFRFAIGPQFFTEIAKFRAFRPLWTRVVTAFGATaDtAAGASVHAVTGHWDKTLLDPHVNLLRVTTEALSAVL 359 Opitutus terrae
jgi:RoseRS_0544 288 HVVAPRMQFAFSIGSQFFMEIARLRAARMLWARVVSAFGGDeQ-AQKMRIHGRTSAWTKARFDAYNNMLRATGEAMAGVM 366
BAH43664        277 EDIAARMQFSYSIGSDVFMEIAKLRAARMLWSNIVAAYGGStE-AQKMTIHARTSAWTKTIYDPYVNMLRSTTEAFSAVI 355
WP_011735208    289 NDITPRMRFGFSLGSNFFVEIAKLRAARILWNQVVAAFGGSeQ-ARKMRIHGRTSAYNKTVCDPHVNMLRITSEGFSGAV 367 Pelobacter p...
WP_012609369    287 DVIAPKVCFSFSVGGHFFMEIAKLRAARILWTQIADAFGGNeE-SQKMFMFARTSAWTKTLCDPYVNMLRNTTECFAAAM 365 Desulfatibac...
WP_012258368    288 NEVAPRMQFACSVGANFFLEVARLRAMRMLWARIVAAFDGNeQ-AQRIHLHVRTSAWTKTRYDVYNNMLRATGEAMAAVM 366 Chloroflexus...
6OXC_B          337 GGADTVLVHPFDVAIpggfpGTAAGFARRIARNTQLLLLEESHVGRVLDPAGGSWFVEELTDRLARRAWQRFQAIEARGG 416 Mycobacteriu...
WP_014561285    362 GGVDALTTNPFDEVF-----DVPDQFSRRISRNTQIILKEESHLDQVIDPAAGSFFVEALTAQLAESAWKLFQQIDESGG 436 Ignavibacter...
WP_013042549    356 AGVDSLCVGNFDEVT-----RLPDTFARRISRNTQVILQEECELTGVVDPAGGSWAVEWLTNEVCEKSWALFQEIEAKGG 430 Coraliomarga...
WP_009513003    353 GGVDSLHIAPFDELS-----GKTDAFSRRIARNVHTLLAEEFSFTQVADPAGGSWYVEKLTDELGRKAWALFQDIEARGG 427 Opitutaceae ...
WP_012376113    360 GGCDSLHIAPFDEVA-----GSSDEFSRRIARNVHTLLAEEFSFAETADPAGGSWYVEKLTDTLARNAWALFQDIESKGG 434 Opitutus terrae
jgi:RoseRS_0544 367 GGIDSLHVSHFDEAL-----GLPDEFSRRIARNVQIILQEECNFIRVIDPPGGAWAIETLTDQVAQKAWALFQEIERKGG 441
BAH43664        356 GGADSLHVSAFDEAI-----RPVNEFSRRIARNTQIILQEEAHLAKVIDPAGGSWYVEWLTDALAKKAWELFQQVEAHGG 430
WP_011735208    368 GGVDSMHLAPFDEPV-----RVPDRFSRRIARNAQIILQEEARFTIPIDMGGGSYFIEKMTDEFARATWALFQEIEGMGG 442 Pelobacter p...
WP_012609369    366 GGADMIYVAPFDEVA-----RQPNEFSRRVSRNLQIVLQEESRFTQPVDPSGGSWYVETLTNTVAEKAWGIFQEIEKAGG 440 Desulfatibac...
WP_012258368    367 GGAHSLHISHFDEAW-----GLPDEFSRRIARNLHIILQEECNFFRLIDPPGGSWAVEKLTDEIAAQAWAFFQEIERHGG 441 Chloroflexus...
6OXC_B          417 FVEAHD--FLAGQIAECAARRADDIAHRRLAITGVNEYpNLgEPALPPGDPTs---------------------pVRRYA 473 Mycobacteriu...
WP_014561285    437 MFKAIEsgFVQDEVNKIAEAKRKDFAKRKSILVGANMYaNPkEELPEPKSPDye-------------------tiYKKRV 497 Ignavibacter...
WP_013042549    431 ITGALKagFVQDKVASTAAGMEKQLNGRRMSLVGTNVYpDVaETPLDVKLPDyk-------------------eiKKNRS 491 Coraliomarga...
WP_009513003    428 HAAALRtgYLQDLVAKTAQEKLDAVGKRRAGIIGTNLFpNLrETPLAPAACAtsagkpaaapapapakhdgikpvAFRRA 507 Opitutaceae ...
WP_012376113    435 LTAALRagYPQQLVAKAAGEKADAIAKRRLGLVGTNLFpNLkEKPLAPVSVD-----------------------TNVRA 491 Opitutus terrae
jgi:RoseRS_0544 442 MADALVagFPQSFVAATRAERFSAIAHRREVIVGVNMYpNLkEKPLTVRMVDha-------------------avQAERS 502
BAH43664        431 MLSALEagFPQDLIAQSADQKAASIDTRKKRLVGTNMYaNTaEQPLKAESLLs---------------------iHEERA 489
WP_011735208    443 MTAAIAnsHPQKRAAATAASRAKRIATRQDVILGTNMYaNItEKKLEIPEIDla-------------------giRQQRM 503 Pelobacter p...
WP_012609369    441 MAKALEqgLPQSMCAEVAEQKAKNIKKRKDVFVGTNMYaNLaEKPLEVPVVDha-------------------alQSERA 501 Desulfatibac...
WP_012258368    442 MAAALAagMPQEAIAATRNERFAAIAQRRDVIIGINMYpNLdEKRPEFRQIDhl-------------------qlHAARA 502 Chloroflexus...
6OXC_B          474 AGF-EALRDRsdhhlaRTGARPRVLLLPLGPLAEh-------nIRTTFATNLLASGGiEA 525 Mycobacterium tuberculosis
WP_014561285    498 EYI-QKYRIS------GDDQKHKNILDKLQIIADtksy--dlvETAIEAYIDGAAIG-EV 547 Ignavibacterium album
WP_013042549    492 QDI-AAARTA------QSEDADAQVMAALGKILEsngd--tllDSLIAAVEAGATLG-EI 541 Coraliomargarita akajimensis
WP_009513003    508 AEQfEALRAAsaafakKTGKAPQIFFARMGPVIQh-------kARADFAAGFFATAGfEc 560 Opitutaceae bacterium TAV5
WP_012376113    492 AELvARVRAR------RRGPQSPAPISDWNAr----------fNAALAAARDGATVG-EL 534 Opitutus terrae
jgi:RoseRS_0544 503 AEV-QRVRHA------VDPQARQDALGALTQTLAaapd--rlvERAIAAARIGATLG-DL 552
BAH43664        490 EEA-RSHRLQ------QNATLVSAALDGLGEhnd------elvAIAVKAVLLGATVG-DI 535
WP_011735208    504 DAV-ADYRMK------HASTSLAEQLTALSNSIRdnad--qtmATAMEAAKNGATLG-DI 553 Pelobacter propionicus
WP_012609369    502 AQV-EEFC--------KAAGNGGDMLKALEEAMKdspaapetmDKAVAAAQAGASLS-AI 551 Desulfatibacillum aliphaticivorans
WP_012258368    503 ADL-RHSRDN------RSDEACRTALSNLATqr--------svAAVLAAVRAGATLG-EL 546 Chloroflexus aurantiacus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap