Conserved Protein Domain Family
HCV_NS1

?
pfam01560: HCV_NS1 
Hepatitis C virus non-structural protein E2/NS1
The hypervariable region of the E2/NS1 region of hepatitis C virus varies greatly between viral isolates. E2 is thought to encode a structurally unconstrained envelope protein.
Statistics
?
PSSM-Id: 110557
View PSSM: pfam01560
Aligned: 10 rows
Threshold Bit Score: 737.43
Threshold Setting Gi: 130469
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P26661  386 YSSGQEAGRTVAGFAGLFTTGAKQNLYLINTNGSWHINRTALNCNDSLQTGFLASLFYTHKFNSSGCPERLSSCRGLDDF 465  Hepatitis C virus i...
Q00269  386 YTTGGSQARHTQSVTSFFTQGPAQRIQLINTNGSWHINRTALNCNESLNTGFFAALFYAHKFNSSGCPERMASCSSIDKF 465  Hepatitis C virus (...
P26662  386 HVTGGRVASSTQSLVSWLSQGPSQKIQLVNTNGSWHINRTALNCNDSLQTGFIAALFYAHRFNASGCPERMASCRPIDEF 465  Hepatitis C virus (...
P29846  386 IVSGGTVARTTHSLASLFTQGASQKIQLINTNGSWHINRTALNCNDSLQTGFLASLFYAHRFNASGCPERMASCRSIDKF 465  Hepatitis C virus (...
P26663  386 HVTGGAQAKTTNRLVSMFASGPSQKIQLINTNGSWHINRTALNCNDSLQTGFLAALFYTHSFNSSGCPERMAQCRTIDKF 465  Hepatitis C virus (...
P27958  386 HVTGGNAGRTTAGLVGLLTPGAKQNIQLINTNGSWHINSTALNCNESLNTGWLAGLFYQHKFNSSGCPERLASCRRLTDF 465  Hepatitis C virus (...
P26664  386 HVTGGSAGHTVSGFVSLLAPGAKQNVQLINTNGSWHLNSTALNCNDSLNTGWLAGLFYHHKFNSSGCPERLASCRPLTDF 465  Hepatitis C virus (...
P27961  386 QVTGGQAAHTVRGVASIFSPGSRQDISLINTNGSWHINRTALNCNDSLQTGFFAALFYVRRFNSSGCPERLSSCRKLDDF 465  Hepatitis C virus H...
P27960  386 RTVAGSAAATTRGFTSMFSSGSKQNLQLINTNGSWHINRTALNCNDSLNTGFIASLFYVNRFNSSGCPHRLSVCRSIEAF 465  Hepatitis C virus H...
P26660  386 HTVGGSTAHNARTLTGMFSLGARQKIQLINTNGSWHINRTALNCNDSLHTGFLASLFYTHSFNSSGCPERMSACRSIEAF 465  Hepatitis C virus i...
P26661  466 RIGWGTLEYETnvTNDGDMRPYCWHYPPRPCGIVPARTVCGPVYCFTPSPVVVGTTDKQGVPTYTWGENETDVFLLNSTR 545  Hepatitis C virus i...
Q00269  466 AQGWGPITYTE--PRDLDQRPYCWHYAPRQCGIVPASQVCGPVYCFTPSPVVVGTTDRSGAPTYNWGANETDVLLLNNTR 543  Hepatitis C virus (...
P26662  466 AQGWGPITHDM--PESSDQRPYCWHYAPRPCGIVPASQVCGPVYCFTPSPVVVGTTDRFGAPTYSWGENETDVLLLSNTR 543  Hepatitis C virus (...
P29846  466 DQGWGPITYTE--ADIQDQRPYCWHYAPRPCGIVPASQVCGPVYCFTPSPVVVGTTDRFGAPTYSWGENETDVLILNNTR 543  Hepatitis C virus (...
P26663  466 DQGWGPITYAE--SSRSDQRPYCWHYPPPQCTIVPASEVCGPVYCFTPSPVVVGTTDRFGVPTYRWGENETDVLLLNNTR 543  Hepatitis C virus (...
P27958  466 AQGWGPISYAN--GSGLDERPYCWHYPPRPCGIVPAKSVCGPVYCFTPSPVVVGTTDRSGAPTYSWGANDTDVFVLNNTR 543  Hepatitis C virus (...
P26664  466 DQGWGPISYAN--GSGPDQRPYCWHYPPKPCGIVPAKSVCGPVYCFTPSPVVVGTTDRSGAPTYSWGENDTDVFVLNNTR 543  Hepatitis C virus (...
P27961  466 RIGWGTLEYETnvTNEEDMRPYCWHYPPKPCGIVSAKTVCGPVYCFTPSPVVVGTTDRQGVPTYSWGENETDVFLLNSTR 545  Hepatitis C virus H...
P27960  466 RIGWGTLQYEDnvTNPEDMRPYCWHYPPKPCGIVPARSVCGPVYCFTPSPVVVGTTDARGVPTYTWGENETDVFLLNSTR 545  Hepatitis C virus H...
P26660  466 RVGWGALQYEDnvTNPEDMRPYCWHYPPRQCGVVSASSVCGPVYCFTPSPVVVGTTDRLGAPTYTWGENETDVFLLNSTR 545  Hepatitis C virus i...
P26661  546 PPRGAWFGCTWMNGTGFTKTCGAPPCRIRKDYNSTidLLCPTDCFRKHPDATYLKCGAGPWLTPRCLVDYPYRLWHYPCT 625  Hepatitis C virus i...
Q00269  544 PPQGNWFGCTWMNSTGFTKTCGGPPCNIGGVGNLT--LTCPTDCFRKHPEATYTKCGSGPWLTPRCIVDYPYRLWHYPCT 621  Hepatitis C virus (...
P26662  544 PPQGNWFGCTWMNSTGFTKTCGGPPCNIGGVGNNT--LVCPTDCFRKHPEATYTKCGSGPWLTPRCMVDYPYRLWHYPCT 621  Hepatitis C virus (...
P29846  544 PPQGNWFGCTWMNSTGFTKTCGGPPCNIGGGGNNT--LVCPTDCFRKHPEATYTKCGSGPWLTPRCMVDYPYRLWHYPCT 621  Hepatitis C virus (...
P26663  544 PPQGNWFGCTWMNSTGFTKTCGGPPCNIGGVGNNT--LTCPTDCFRKHPEATYTKCGSGPWLTPRCMVDYPYRLWHYPCT 621  Hepatitis C virus (...
P27958  544 PPLGNWFGCTWMNSTGFTKVCGAPPCVIGGVGNNT--LLCPTDCFRKYPEATYSRCGSGPRITPRCMVDYPYRLWHYPCT 621  Hepatitis C virus (...
P26664  544 PPLGNWFGCTWMNSTGFTKVCGAPPCVIGGAGNNT--LHCPTDCFRKHPDATYSRCGSGPWITPRCLVDYPYRLWHYPCT 621  Hepatitis C virus (...
P27961  546 PPRGAWFGCTWMNGTGFTKTCGAPPCRIRRDYNGTldLLCPTDCFRKHPDTTYLKCGAGPWLTPRCLVDYPYRLWHYPCT 625  Hepatitis C virus H...
P27960  546 PPRGSWFGCTWMNSTGFTKTCGAPPCRIRADFNAStdLLCPTDCFRKHSDATYIKCGSGPWLTPKCMVDYPYRLWHYPCT 625  Hepatitis C virus H...
P26660  546 PPQGSWFGCTWMNSTGYTKTCGAPPCRIRADFNASmdLLCPTDCFRKHPDTTYIKCGSGPWLTPRCLIDYPYRLWHYPCT 625  Hepatitis C virus i...
P26661  626 VNFTIFKARMYVGGVEHRFSAACNFTRGDRCRLEDRDRGQQSPLLHSTTEWAVLPCSFSDLPALSTGLLHLHQNIVDVQY 705  Hepatitis C virus i...
Q00269  622 VNFTIFKVRMYVGGVEHRLSAACNWTRGERCDLEDRDRSELSPLLLSTTEWQTLPCSFTTLPALSTGLIHLHQNIVDVQY 701  Hepatitis C virus (...
P26662  622 VNFTVFKVRMYVGGVEHRLNAACNWTRGERCDLEDRDRSELSPLLLSTTEWQILPCSFTTLPALSTGLIHLHRNIVDVQY 701  Hepatitis C virus (...
P29846  622 VNFTIFKVRMYVGGVEHRLNAACNWTRGERCDLEDRDRSELSPLLLSTTEWQILPCSFTGLPALSTGLIHLHQNVVDVQY 701  Hepatitis C virus (...
P26663  622 VNFTIFKVRMYVGGVEHRLNAACNWTRGERCDLEDRDRPELSPLLLSTTEWQVLPCSFTTLPALSTGLIHLHQNIVDVQY 701  Hepatitis C virus (...
P27958  622 INYTIFKVRMYVGGVEHRLEAACNWTRGERCDLEDRDRSELSPLLLSTTQWQVLPCSFTTLPALSTGLIHLHQNIVDVQY 701  Hepatitis C virus (...
P26664  622 INYTIFKIRMYVGGVEHRLEAACNWTRGERCDLEDRDRSELSPLLLTTTQWQVLPCSFTTLPALSTGLIHLHQNIVDVQY 701  Hepatitis C virus (...
P27961  626 VNFTIFKVRMYVGGVEHRLDAACNFTRGDRCRLEDRDRSQQSPLLHSTTEWAVLPCSYSDLPALSTGLLHLHQNIVDVQY 705  Hepatitis C virus H...
P27960  626 VNYSIFKIRMYVGGVEHRLTAACNFTRGDPCNLEDRDRSQLSPLLHSTTEWAILPCTYSDLPALSTGLLHLHQNIVDVQY 705  Hepatitis C virus H...
P26660  626 VNYTIFKIRMYVGGVEHRLTAACNFTRGDRCNLEDRDRSQLSPLLHSTTEWAILPCTYSDLPALSTGLLHLHQNIVDVQF 705  Hepatitis C virus i...
P26661  706 LYGLSPALTRYIVKWEWVILLFLLLADA 733  Hepatitis C virus isolate HC-J8
Q00269  702 LYGIGSAVVSFVIKWEYIVLLFLLLADA 729  Hepatitis C virus (isolate HC-JT)
P26662  702 LYGIGSAVVSFAIKWEYILLLFLLLADA 729  Hepatitis C virus (isolate Japanese)
P29846  702 LYGIGSAVVSFAIKWEYILLLFLLLADA 729  Hepatitis C virus (isolate Taiwan)
P26663  702 LYGIGSAVVSFAIKWEYVLLLFLLLADA 729  Hepatitis C virus (isolate BK)
P27958  702 LYGVGSSIASWAIKWEYVVLLFLLLADA 729  Hepatitis C virus (isolate H)
P26664  702 LYGVGSSIASWAIKWEYVVLLFLLLADA 729  Hepatitis C virus (isolate 1)
P27961  706 LYGLSPAITRHIVKWEWVILLFLLLADA 733  Hepatitis C virus HC-J7
P27960  706 MYGLSPALTKYVVRWEWVVLLFLLLADA 733  Hepatitis C virus HC-J5
P26660  706 MYGLSPALTKYIVRWEWVVLLFLLLADA 733  Hepatitis C virus isolate HC-J6
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap