2QFI


Conserved Protein Domain Family
Cation_efflux

?
pfam01545: Cation_efflux 
Click on image for an interactive view with Cn3D
Cation efflux family
Members of this family are integral membrane proteins, that are found to increase tolerance to divalent metal ions such as cadmium, zinc, and cobalt. These proteins are thought to be efflux pumps that remove these ions from cells.
Statistics
?
PSSM-Id: 426316
Aligned: 60 rows
Threshold Bit Score: 67.6814
Created: 19-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2QFI_A           22 L-LLLIKIFAWWYT-GSVSILAALVDSLVD-IGASLTNLLVVRYS-LQPADDNHSFGHGKAESLAALAQSMFISGSALFL 97  Escherichia ...
jgi:OSTLU_33926 106 V-LLGVKLFAAISS-GSLSIITSALDSFLD-LVSGLILFMTDKTI-RKQNKYLYPIGKSRMQPLGIIVFSCIMGTLGFQV 181 Ostreococcus...
XP_001584032    188 Y-----GIMSGIKL-GAGPLIISSELSLYN-TISLMIVLFGEIIA-REPISKEFSYGKGRIKYVFQLTSSIIILYSAFFL 259 Trichomonas ...
EAY09660        149 V-LNFYTLYYSMTH-HALTLMADALSSLAN-NIAFVGAIVSDVAT-RMNNTKTFSFGFVSCKPVTDLSAAILQSIVLFRI 224 Trichomonas ...
EAY22179        234 V-SFYYEYRQGVIL-ESYNITFDSLYMVPI-LISLFVTYLALVFT-NKEYSKQYRYGFSNTLNIFSLVDSIFLIVGIVLY 309 Trichomonas ...
Q8ZUM0           14 G-ATAVSALGYVFS-NSVVVLGDFLHGVAD-ALGITLAVLAAWLV-ARDPGGVFTYGYHRAESLAIFTNAVMILFGSIYV 89  Pyrobaculum ...
EAY01254         50 A-FFSVLLAQSILT-KSTVFVQIAFIQLLH-FALYAIILLTDYYT-TLPPDECHTYGYARSMIVCCFSVSLTVILFACSL 125 Trichomonas ...
Q9YBI3           61 L-MAAAGVTLYLLVfPSSVVLVEAFVWFVE-AITFFSLAVAFNIAaSRTVYYKARFEILRIESLMALHSALVGVAVVVFV 138 Aeropyrum pe...
O14329          110 G-VLLSGDATILLT-LSCSLIVEGVLIIIN-VWRETLDSFLVW----RHTCLRYPFGMQQMELLVDFSFSILLIFLGMNL 182 Schizosaccha...
Q97WI8           22 IpIFLSELIAGILF-KSYVLMADSYHTLIDfLMSFIFYFTLIKINtRS---KRFPWGLYNLESLVVLTASIFIVYLSTNL 97  Saccharolobu...
2QFI_A           98 FLTGIQHLI-----------SPTPMTDPGVGVIVTIVALICTIILVSFQRWVVRRT-------QSQAVRADMLHYQS--- 156 Escherichia ...
jgi:OSTLU_33926 182 LIEGIRQLIgd--------eHTHHLEHLVLTIGIMCGVIVLKFFLFLFCRNS-----------TSSSVQTYAQDHRN--- 239 Ostreococcus...
XP_001584032    260 LVDNTTSCFm----------DSIYVRDPSRVVLLSLVDFGISLF-------------------GAISIGNAALTSFSlmc 310 Trichomonas ...
EAY09660        225 FIDTINAFIee--------dEITGNDNDPMLLVLSILGLVVTALGVFFVGGNDDDKnnekeqkSKCSFDSETLMVLC--- 293 Trichomonas ...
EAY22179        310 TMDTIKKEWy---------lSSVGSDRNSFVLIIVIIILIISYFFIFEWRN------------LENIHKVISFHIEI--- 365 Trichomonas ...
Q8ZUM0           90 AYEAALRFF------------KGVEIDPLWMLYSSSAALILSVVSAVLLKGR-----------SEANLKAAYLHALA--- 143 Pyrobaculum ...
EAY01254        126 LLDSLKEFLssvap-daslsVEHPSFSPVMPNIFALIAYGISALLLSQYRSNPSQS-------KYPHFHAAFLVAIS--- 194 Trichomonas ...
Q9YBI3          139 MWKALf--------------SKGSEPTPILLALYPGVSGLVSYVIERYLFGKLKRLe-----vRLVSLKFVAEKLRL--- 196 Aeropyrum pe...
O14329          183 LKEPAEHAIedwgnlhhagdHEEETVHIHLTISLFASAIISGFALLLDHPSA-----------HIRELNSRFFHGLTlvp 251 Schizosaccha...
Q97WI8           98 ILSMFDNAI--------------TLSISPWYSIILFVSSIYSLTLFLIERRYV----------EIQIVKNDMIHSLL--- 150 Saccharolobu...
2QFI_A          157 DVM----MNGAILLALGLSW----YGwh-rADALFALGIGIYILYSALRMGYEAVQSLL 206 Escherichia coli
jgi:OSTLU_33926 240 DVAtnsiGLAAALVGDRVYYw---------VDPLGAILLAIYIVINWSQTAMENIRSMV 289 Ostreococcus lucimarinus CCE9901
XP_001584032    311 DIF----ISSSALISSLFDYlfnfPS----FDIVISYFIIVTIFITTVSELRDSLYALM 361 Trichomonas vaginalis G3
EAY09660        294 DLF----GSIAVVTSSFLISvfn----mkfIDPYVSLFNAVMVSIVTYPSIKDAATILC 344 Trichomonas vaginalis G3
EAY22179        366 LIL----YHVVELISHFLALyldfYW----FEFFARMAAAIYSFYAAFPHLRNSISELL 416 Trichomonas vaginalis G3
Q8ZUM0          144 DSL----TSIIALASAVSIIlag----iplIDAVLGLGISAYLFSRALPLFESSLLSLL 194 Pyrobaculum aerophilum
EAY01254        195 GIL----HSLSKLVTAFLPFpsvpEHvseqAIPLLNGLIALFIIDRARELLVPSFFVLM 249 Trichomonas vaginalis G3
Q9YBI3          197 DVLleeaGAAVIIVTNLTGLt--------vFETVIVVGVGLYLLYGLGSIALKNLLYLV 247 Aeropyrum pernix
O14329          252 SLIlvllLSLGYQVGSF-------------LSHLLSLTIAVTALVNGFSIAKSLALMLL 297 Schizosaccharomyces pombe 972h-
Q97WI8          151 DGV----TEVVSGVTLILQNt--------vLMDTVTLLILAFTLSDVVREIKDSIVSIL 197 Saccharolobus solfataricus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap