Conserved Protein Domain Family

pfam01539: HCV_env 
Hepatitis C virus envelope glycoprotein E1
PSSM-Id: 110536
Aligned: 4 rows
Threshold Bit Score: 363.43
Threshold Setting Gi: 130468
Created: 19-Apr-2021
Updated: 29-Sep-2021
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
P27958  353 WGVLAGIKYFSMVGNWAKVLVVLLLFAGVD 382  Hepatitis C virus (isolate H77)
P26662  353 WGVLAGLAYYSMVGNWAKVLIVMLLFAGVD 382  Hepatitis C virus (isolate Japanese)
P26660  353 WGVMFGLAYFSMQGAWAKVVVILLLAAGVD 382  Hepatitis C virus isolate HC-J6
P26661  353 WGVVFGLAYFSMQGAWAKVIAILLLVAGVD 382  Hepatitis C virus isolate HC-J8
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap