Conserved Protein Domain Family
HCV_env

?
pfam01539: HCV_env 
Hepatitis C virus envelope glycoprotein E1
Statistics
?
PSSM-Id: 110536
View PSSM: pfam01539
Aligned: 4 rows
Threshold Bit Score: 363.43
Threshold Setting Gi: 130468
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P27958  193 QVRNSSGLYHVTNDCPNSSVVYEAADAILHTPGCVPCVREGNASRCWVAVTPTVATRDGKLPTTQLRRHIDLLVGSATLC 272  Hepatitis C virus (...
P26662  193 EVRNVSGIYHVTNDCSNSSIVYEAADMIMHTPGCVPCVRESNFSRCWVALTPTLAARNSSIPTTTIRRHVDLLVGAAALC 272  Hepatitis C virus (...
P26660  193 EVKNISTGYMVTNDCTNDSITWQLQAAVLHVPGCVPCEKVGNTSRCWIPVSPNVAVQQPGALTQGLRTHIDMVVMSATLC 272  Hepatitis C virus i...
P26661  193 EVRNISSSYYATNDCSNNSITWQLTDAVLHLPGCVPCENDNGTLHCWIQVTPNVAVKHRGALTRSLRTHVDMIVMAATAC 272  Hepatitis C virus i...
P27958  273 SALYVGDLCGSVFLVGQLFTFSPRHHWTTQDCNCSIYPGHITGHRMAWNMMMNWSPTAALVVAQLLRIPQAIMDMIAGAH 352  Hepatitis C virus (...
P26662  273 SAMYVGDLCGSVFLVSQLFTFSPRRYETVQDCNCSIYPGHVSGHRMAWDMMMNWSPTTALVVSQLLRIPQAVVDMVAGAH 352  Hepatitis C virus (...
P26660  273 SALYVGDLCGGVMLAAQMFIVSPQHHWFVQDCNCSIYPGTITGHRMAWDMMMNWSPTATMILAYAMRVPEVIIDIIGGAH 352  Hepatitis C virus i...
P26661  273 SALYVGDVCGAVMILSQAFMVSPQRHNFTQECNCSIYQGHITGHRMAWDMMLSWSPTLTMILAYAARVPELVLEIIFGGH 352  Hepatitis C virus i...
P27958  353 WGVLAGIKYFSMVGNWAKVLVVLLLFAGVD 382  Hepatitis C virus (isolate H)
P26662  353 WGVLAGLAYYSMVGNWAKVLIVMLLFAGVD 382  Hepatitis C virus (isolate Japanese)
P26660  353 WGVMFGLAYFSMQGAWAKVVVILLLAAGVD 382  Hepatitis C virus isolate HC-J6
P26661  353 WGVVFGLAYFSMQGAWAKVIAILLLVAGVD 382  Hepatitis C virus isolate HC-J8
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap