Conserved Protein Domain Family
Col_cuticle_N

?
pfam01484: Col_cuticle_N 
Nematode cuticle collagen N-terminal domain
The function of this domain is unknown. It is found in the N-terminal region of nematode cuticle collagens, see pfam01391. Cuticle is a tough elastic structure secreted by hypodermal cells and is primarily composed of collagen proteins.
Statistics
?
PSSM-Id: 426284
Aligned: 243 rows
Threshold Bit Score: 34.359
Created: 26-Apr-2021
Updated: 29-Sep-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q17402          8 FATILLIVFAVLTILASIFSVFNEIENFEITSLEDLKTFEKYSDDAWN 55  Caenorhabditis elegans
XP_002648949    7 gVVTTVTAVSVVTAIIISASILIDINNFSDEISQDLTQFRGYYDDAWR 54  Caenorhabditis briggsae
7_pfamImport    1 -VTTTVTAVSVVAAIFISASLLVDINNFYDEVNGDLSQFRGYYDDAWR 47 
O61525          6 TFIIVISAVSIFGALCVAASILVGINEFHTIVSEDLRDFKGYFGNAWK 53  Caenorhabditis elegans
29_pfamImport   1 TFIIVVSAGSIFGALCFAATILVDINSFRSNIVDDLGEFKDLFDDAWK 48 
CAP38121        6 TFIILISAISIFGSLCISVAILIGINEFHSEVAGDLGDFKGYFDDAWK 53  Caenorhabditis briggsae
EFO92336        6 tCIIIASAASIFGSLCVSVSILVGINEFHNEISDDLGDFRGYFDDAWK 53  Caenorhabditis remanei
EGT52663        6 TVVIVLSAASIFSALCISVSILVGINEFHTEIQHDLNGFKGYFEDAWK 53  Caenorhabditis brenneri
XP_002631032   11 NGIIVSCTVSIVVAIFGCGYILSDISDFQNVIHGDMKEFQFYSSDSWS 58  Caenorhabditis briggsae
EGT39402        9 FVVTSASALAALTAIFSAVHVMTDISNFQDEVLTDLSSFKQYADDAWG 56  Caenorhabditis brenneri
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap