3EDH,4GWN


Conserved Protein Domain Family
Astacin

?
pfam01400: Astacin 
Click on image for an interactive view with Cn3D
Astacin (Peptidase family M12A)
The members of this family are enzymes that cleave peptides. These proteases require zinc for catalysis. Members of this family contain two conserved disulphide bridges, these are joined 1-4 and 2-3. Members of this family have an amino terminal propeptide which is cleaved to give the active protease domain. All other linked domains are found to the carboxyl terminus of this domain. This family includes: Astacin, a digestive enzyme from Crayfish. Meprin, a multiple domain membrane component that is constructed from a homologous alpha and beta chain. Proteins involved in morphogenesis and Tolloid from drosophila.
Statistics
?
PSSM-Id: 426242
Aligned: 22 rows
Threshold Bit Score: 256.439
Created: 19-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3EDH_A   8 RVWPDG-VIPFVIGGNFTGSQRAVFRQAMRHWEKHTCVTFLERTDE----DSYIVFTYRPCGCCSYVGRRgGGPQAISIG 82  human
4GWN_A   8 YRWPHT--IPYVLEDSLEMNAKGVILNAFERYRLKTCIDFKPWAg-----ETNYISVFKGSGCWSSVGNRrVGKQELSIG 80  human
Q16819  73 TRWTFP--IPYILADNLGLNAKGAILYAFEMFRLKSCVDFKPYEg-----ESSYIIFQQFDGCWSEVGDQ-HVGQNISIG 144 human
Q7JLI1 169 TTWGSS--VYYYYDRTATPKIVKAFEQAVAFWQNVTCINIMQSSt-----AINRIRVFKGQGCYSYVGRI-SGVQDLSLG 240 Caenorhabditis elegans
Q21178  69 KKWPDA-KVFYYYENEFTSLKRELMSYAMAHISSNTCVKFQESNs-----ATNRIRFTNTGGCASYIGMN-GGEQTLWFG 141 Caenorhabditis elegans
Q18206 134 ATWKTM-PIKYRFHESIDFYTISQIIAAIRFWEDSTCITFENVSDSp---DGDYIEFFSGQGCYSMIGRN-GGRQGISIG 208 Caenorhabditis elegans
Q20942 122 kKWDTRgPISFDYAESIPFQTRQKIRSAMLLWQQHTCLRFEEGGp-----NVDRLEFFDGGGCSSFVGRV-GGTQGISIS 195 Caenorhabditis elegans
P55114 200 TTWSRN--IPYRFLDT-DGNWQSQITNGLRHYERNTCIRFSLNGg-----GSDYLVFSKGEGCYSSVGRL-GGPQEISIG 270 Caenorhabditis elegans
Q93243 122 NFWPNLt-ISYEFYGG-EETWRQLIRSAIRHVEQNVCFKFKENGg-----DRDGLRYYRGNGCWSNVGRV-GGRQLVSIG 193 Caenorhabditis elegans
Q21059 132 ERWSFP--VPYYIDTS-SGVNTNAVLAGVAKWEQETCARFTRLNSYssssRQNALRFISGNGCYSNIGKVsRFPQDVSIG 208 Caenorhabditis elegans
3EDH_A  83 -KNCDKFGIVVHELGHVVGFWHEHTRPDRDRHVSIVRENIQPGQEYNFLKMEPQEVESLGETYDFDSIMHYARNTFSRGI 161 human
4GWN_A  81 -ANCDRIATVQHEFLHALGFWHEQSRSDRDDYVRIMWDRILSGREHNFNTYSDDISDSLNVPYDYTSVMHYSKTAFQ-NG 158 human
Q16819 145 -QGCAYKAIIEHEILHALGFYHEQSRTDRDDYVNIWWDQILSGYQHNFDTYDDSLITDLNTPYDYESLMHYQPFSFNKNA 223 human
Q7JLI1 241 -TGCEEFGTAAHELGHALGFFHTQSRYDRDNYISINYANIDPSYVEQFDKETSNTNFNYGMPYDYGSIMQYGATSASSND 319 Caenorhabditis elegans
Q21178 142 -DGCLIFGTAVHEIMHSLGLFHTHSRFDRDNFLSVSYKDVPENMVGNLEKET-EQTTYNAVPFEYGSTMLYRYNTFG-EG 218 Caenorhabditis elegans
Q18206 209 -ESCVKMGVIEHEIGHALGLWHEQSRPDALGYVTIERDFILPSYISDFLQRD-DEIDTLGIPYDLGSVMHYGSTAFSVDQ 286 Caenorhabditis elegans
Q20942 196 tPGCDVVGIISHEIGHALGIFHEQARPDQERHIAINYNNIPLSRWNNFQAVGENHAETYNLPYDTGSVMHYGPYGFASDP 275 Caenorhabditis elegans
P55114 271 -DGCETLGIITHEVGHALGFWHEQARPERDSYVRINRQNAINGLEGQFDKRSWSEVNEYSLPYDYGSVMHYGPKSFSKSS 349 Caenorhabditis elegans
Q93243 194 -YGCDSLGIVSHETLHALGLWHEQSRDDRDNFISIVADKITRGTEGNFAKRTAANSDNLGQPYDLGSVMHYGAKSFAYDW 272 Caenorhabditis elegans
Q21059 209 -WGCTSLGTVCHEIGHALGFYHEQARYDRDDYVSILTQNIQDMYLSQFTKQSASSMVDYGVGYDYGSVMHYDQAAFSSTG 287 Caenorhabditis elegans
3EDH_A 162 FLDTIVPKYEVngVKPPIGQRTRLSKGDIAQARKLYkCPA 201 human
4GWN_A 159 TEPTIVTRISD--FEDVIGQRMDFSDSDLLKLNQLYnCSS 196 human
Q16819 224 SVPTITAKIPE--FNSIIGQRLDFSAIDLERLNRMYnCTT 261 human
Q7JLI1 320 -KATMIARDTE--YQDTMGSDF-VGFYDISMMNEHYkCKE 355 Caenorhabditis elegans
Q21178 219 ---TLVSKNED--YQKTMGLRR-VSFYDLVNINVRYsCGC 252 Caenorhabditis elegans
Q18206 287 KSKTVVTRDSL--YQQTIGQREKLSFYDVATINTAY-CKD 323 Caenorhabditis elegans
Q20942 276 YTPTIRTLERV--QQSTIGQRAGPSFLDYQAINMAYgCTE 313 Caenorhabditis elegans
P55114 350 TMNTVEPVDPA--FINTIGNRVEPSFLDLKLLNTAF-CSN 386 Caenorhabditis elegans
Q93243 273 SSDTIKTRDWR--YQNTIGQRDGLSFKDAKMINTRY-CSN 309 Caenorhabditis elegans
Q21059 288 G-NTIATRDPN--FQATIGQRVAPSFADVKRINFAY-CNS 323 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap