3KOR


Conserved Protein Domain Family
Trp_repressor

?
pfam01371: Trp_repressor 
Click on image for an interactive view with Cn3D
Trp repressor protein
This protein binds to tryptophan and represses transcription of the Trp operon.
Statistics
?
PSSM-Id: 426227
Aligned: 18 rows
Threshold Bit Score: 99.2502
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3KOR_A  28 AALDELFDAILTLENREECYQFFDDLCTVNEIQSLSQRLQVAKx-IKQGYTYATIEQESGASTATISRVKRSLQWGNDAY 106
Q9PC61   5 QAFEMLIKILCKTDSTDDMKLILECILTRSEMEDLIDRIRIYNelLNTNNSQREVASKLGVSITKITRGAANLQ--DNNI 82  Xylella fastidiosa 9a5c
P44889   8 EQWNAFLQMLKIAFEENKAQEFLTLLLTADERDAVGLRLQIVSqlIDKNMPQREIQQNLNTSAATITRGSNMIKTMDPDF 87  Haemophilus influenza...
P58700  33 QHWLSFVALLQNAITQDLHLPLLQLMLTPDERTALGTRVRIIEelMRGELSQRELKSQLGAGIATITRGSNSLKTAPPQL 112 Yersinia pestis
Q9KU28   8 SEWQQVLDLVKQAVQQEQHEMLLTMLMTPDEREALVARVNIVHelLQGELSQRQISQMLGVGIATITRGSNELKSRSEDE 87  Vibrio cholerae O1 bi...
Q87S71   8 RDWQQIVELIRSSVDSQQHEMLLTMLMTPDERESLTARVNILNelLKGELSQRQISQMLGVGIATITRGSNELKSKSEAE 87  Vibrio parahaemolytic...
O84171   7 sGWQAFLTLCSKMQKEKFLQDLFSLFLSFSERKDVASRYHIIRalLEGELTQREIAEKYGVSIAQITRGSNALKGLDPQF 86  Chlamydia trachomatis...
Q5HN27   9 QSLDELFDAILALENREECYQFFDDLCTVNEIQSLSQRLQVAKm-IKQGYTYATIEEESGASTATISRVKRSLQWGNDAY 87  Staphylococcus epider...
Q92AP5   9 QGLDEFFQGILTLENLEECYAFFDDVCTVNEIQSMAQRFQVAKm-LHDGKTYNVIESETGASTATISRVKRSLHYGNDMY 87  Listeria monocytogenes
Q7BVT7   9 KELDQLFNSILSLKDLEECYRFFDDLCTINEIQSLAQRLEVARm-LREGNTYHKIETETGASTATISRVKRCLNYGNDAY 87  Bacillus subtilis sub...
3KOR_A 107 TXILDR 112
Q9PC61  83 KDFLRK 88  Xylella fastidiosa 9a5c
P44889  88 MQWMKQ 93  Haemophilus influenzae Rd KW20
P58700 113 KSWLEA 118 Yersinia pestis
Q9KU28  88 KAALAQ 93  Vibrio cholerae O1 biovar El Tor str. N16961
Q87S71  88 KDKLKL 93  Vibrio parahaemolyticus RIMD 2210633
O84171  87 KEFLQK 92  Chlamydia trachomatis D/UW-3/CX
Q5HN27  88 TMILDR 93  Staphylococcus epidermidis RP62A
Q92AP5  88 DVVFSR 93  Listeria monocytogenes
Q7BVT7  88 EMALDR 93  Bacillus subtilis subsp. subtilis str. 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap