Conserved Protein Domain Family
Adenylate_cycl

?
pfam01295: Adenylate_cycl 
Adenylate cyclase, class-I
Statistics
?
PSSM-Id: 426186
Aligned: 22 rows
Threshold Bit Score: 676.667
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q5E8T4        197 QWIDFGRLNHIPAEEYFGSSLWQLYKSIDSPFKSVLKAILLEAYSWEYPHTQLLSIDSKRRFFADDPD-LYGMDAYYLML 275 Aliivibrio fis...
jgi:Fbal_3692 196 DLLSLGQLSHLPASEFFGAALWQLFKGLDKPHKAGLKVLLLEAYVADYPDQRILRDQLWYRLRAGHS--MVVLDPYLMLY 273
Q088L2        216 sLLYLGDINSLPAAEYFGASLWQLYKGLNKPHKALLKVLLLETYASEYPSTTLITQQIWQYCEQQDF--SVDNDAYLLLY 293 Shewanella fri...
BAJ03811      215 qLLFLGDVSQIPACEYFGASLWQLYKGLDKPHKALLKVLLLESYAAQYPNTEFISEKVWQHTIEGDF--SSANDSYFLLY 292
Q8E9H1        210 ELLSLGNVHELPASEYFGASLWQLYKGLNKPHKALIKVLLLEAYASEYPHSQLLCDRLWQKTLAGDF--STANDAYYAIY 287 Shewanella one...
jgi:Sama_3253 215 dgLWLGDVQSLPASEYFSASLWQLYKGLVKPHKALLKVLLLEAYAWRYPNTEQLSTRVWLHTTKGDF--STANDPYFLLY 292
jgi:Asuc_0361 230 EWVDFGGLGKFSANEYFGASLWQLYKGIDAPYKAVIKILLLEEYSWEYPNTRLIASDFKFHLLMGHTE-DHHFDPYLEML 308
jgi:HSM_1936  234 DWVDFGCLSAFSANEYFGASLWQLYKGIDSPYKSVLKILLLESYSYEYPNTHLIAQEFKQRLLNNDL--DYHYDPYLAML 311
P40134        236 DWVDFGGLGQFSANEYFGASLWHLYKGIDSPYKSVLKILLLEAYSKEYPNTCLIARTFKRDLLAGNTNpDHHFDPYIAIL 315 Haemophilus in...
Q05766        232 DWVDFGGLGQLSANEYFGASLWQLYKGIDAPYKSVIKILLLETYSSEYPNTYLIARQFKEELLTGKLNpSHHFDPYLAML 311 Pasteurella mu...
Q5E8T4        276 EKVTRYLERTNDMSRLELVRRSFYLKTHEKLSRRQGQGSVEWRRKALSELTTQWGWSSEYITELDSRRTWKVEQVKKSHH 355 Aliivibrio fis...
jgi:Fbal_3692 274 QRVSDYLERESDRRRLTMVQRSFYLKCALPLS--DPNSTKDWRYPTLSALTKQWRWTRELILSLDQARHWHAGQLRWCNE 351
Q088L2        294 QRIETYLIAQGDDNRLEIVRRCFYLKSGVTLSCLSPNSAADWRVEKIQNLVKQWAWSHELVATLDNSPYWHAGQLKWFNQ 373 Shewanella fri...
BAJ03811      293 ESIENYLIAKEDPRRLEIVRRCFYLKCGIRLS--EPEQAQDWRYHKLSHLVETWHWSGSLLETLDNCEHWHCGQLQWFNE 370
Q8E9H1        288 EVIEAYLLKQNDSRRLEIVRRCFYLKCGVFLS--LSNQGKDWRYAKMQKLVQEWQWPNSLITTLDDCEHWHSGQLNWFNE 365 Shewanella one...
jgi:Sama_3253 293 EAIEEYLLAIEDHRRLEIVRRCFYLKCAVRLS--HPQQPKDWRYLKMQLLVSAWEWPDALIQTLDDCEDWHTGQLQWFNA 370
jgi:Asuc_0361 309 ERVTDYLTYRKDFKRLDDMRHCFYLKATEDWWYRN---ESNWRVDLINRLAQDWGWSKETIQDLNLRPFWKIKRVKQSYN 385
jgi:HSM_1936  312 ERVSSFLTKLNEFKRLDFVRRCFYMKASEYIVQQQ---ENNWRSEKLHQLTQQWNWSDNLLQNLNQRTTWKIKKVKESHN 388
P40134        316 AKVTQYLTALSEFKRLDFVHRCFYVKATEDFARYQ---ANNWRIRYMEILAQEWGWSAETVKHLNKRPFWKIKAVKENHD 392 Haemophilus in...
Q05766        312 QRATRYLTKHNELKRLGFVRRSVYLKATEGMCWQDPNATNNWRLQHLQKLIQEWDWSDALIEELNQRANWKIKQVKKAHN 391 Pasteurella mu...
Q5E8T4        356 DLLEALMQSYRNLIRFARNNDITSSISPEDISILARKLYAAFEELPGKVTLLNPQISPDLHEADLSFIEVPE-DSINKAG 434 Aliivibrio fis...
jgi:Fbal_3692 352 RLDQLMLASYQRLTGFAARQRFRSRLRFDELGILTRKLYTKFEAEPAKVPLLNPLWSGDLEEEALTLVAVRD-NPHHAKG 430
Q088L2        374 QLSELLLVSYKNLLQFASKQTLSERMRVEELGLLARKLHTYFSEDTHLLQPLNRLWSLSTAEKSLTIFHCRQ-----ASR 448 Shewanella fri...
BAJ03811      371 QLNELMLGSYQTLLQFASTHKLSESLKLSELGLLTRKLHTYFSSDTEQLISLNRLWSNSISEQDLTIVYSHN-----LQE 445
Q8E9H1        366 QLNELLLASYQTLLRFASTHELNEGLKIEELGMLTRKLHTYFSQDEDQIAKLNLLWSRSVAEAEVTMVSSTK-----ENQ 440 Shewanella one...
jgi:Sama_3253 371 QLNELMLVSYQKLLRFAANHGVNEGLRVEDLGMLTRKLHTCFNEDKHLVSKLNPLWSSRLQEPVLTVITSQS-----DGT 445
jgi:Asuc_0361 386 KLMQMLMVSYRNLIDFARKHHVDANIVPQDISILTRKIYTAFEELPGKVLLINPQISTDLSEPYLTFVEVTAtDRPVKKG 465
jgi:HSM_1936  389 DLMQYLMLSYRNLINFGRKHNVNASIMPQDVSILTRKLYTAFEELPGKITLLNQAISLDLSEPHLTFIEVKQ-NKFFKAG 467
P40134        393 NIMKFLMLSYRNLVEFARKHHIHSSVVPQDINILSRKLYTAFEELPGKVSLLNTQISHNLSEAHLTFVEVRG-NKHFKDG 471 Haemophilus in...
Q05766        392 SLIKFLMLSYRNLVAFARKHKVNSSIMPQDISVLTRKLYTAFEELPGKITLLNPQISLNLSEKNLLFFEVKG-SKTFKDG 470 Pasteurella mu...
Q5E8T4        435 WYVYKKP-----------LIAKELMGAKFLEHNRYLSKLVAWAFFNGLLTESTRLDAVVRDADLNIDKFYQMVSDLRNTF 503 Aliivibrio fis...
jgi:Fbal_3692 431 WYLYRRP-----------PQDNQLFGESPLYHADSRLACMAWALNNGLIGENTRIYCHQGGQSWHSRKLSDLCQRLRHVI 499
Q088L2        449 FYLYRQAyldkdpsqavdNDPAHEFDDHSIHEADNICNLVAWSVLNGLATADTQWFQVGRG-KRRTDKLSYLTRKLIPIM 527 Shewanella fri...
BAJ03811      446 YCLYCCP-----------PNRKAFIGQRDVYRSKSRAKLLAWAVMNGVSEKMTRWHELGAS-ERKSVRLIKASQRLRKVF 513
Q8E9H1        441 YYLYRQG-----------PKPLNLLGDSAICKGKSPSALMIWACLNGVSTPETKWYEFGQS-KVKSQRLTDASKRLLNFI 508 Shewanella one...
jgi:Sama_3253 446 HYLYRQE-----------PQASALKGEAAVYVADNLASLLLWACINQVCDDQTQWFSYGE--RRLGARLAATDKRLREAI 512
jgi:Asuc_0361 466 WYMLNQA-----------PEVSGFSHPRYTEYSATLHKLVASAYFNGLLMPHTRLHIQSPNVSLP--ILQEFITNLAETL 532
jgi:HSM_1936  468 WYLVTQK-----------PDVQGLCQKRHIEYGENLNKLVSWAYFNGLLTPITSLYIHSDTVSLK--TLRNFVADLRLSF 534
P40134        472 WYLINQP-----------IHHIMFSKERVIEYGESLNKLVSWAYFNHLLTEKTELSIFSKNVTLS--TLQRFVTNLRQSF 538 Haemophilus in...
Q05766        471 WYVVNQT-----------PSVAGFVQKRYTEYSESLNKLVAWAYFNRILTANTDLHIISPNVSLT--TLRHFVTDLRLSF 537 Pasteurella mu...
Q5E8T4        504 SVY-LPQPTKEELGSPCEVRQLSIFINLESDPTERLKLKPERMNQADADIFSCGSEQNNLIGSVDLVYRNSWHEVRTLNF 582 Aliivibrio fis...
jgi:Fbal_3692 500 V-P-PQQPTMEALQAPWRYTRVVVLCNVEQDPTLHWHGQSLMMDLQGAPVFATGRPKRNLVGSLTLLTENSWGERHCYRF 577
Q088L2        528 H-N-VPTVYKRDLCEPWCYQKIVLITNMDRDPTTQLSEQELILEHVNANILSFGQTKISMVSSVAIVCLNSWGEWQSHRF 605 Shewanella fri...
BAJ03811      514 KPL-AKRVSKMDLYQPWQYRKLVFMLNFNSDSTAQWQGQEVMVDYLNANIFSLGRAEQNMLESIDLLCLNSWGEWRCHHY 592
Q8E9H1        509 D-H-DWRVSKLDLCQPWHFRKLIFILNLDCDPTIGWRGQEMMVDVMNANVFSLGRKQENMLGALDAICLNSWGEWQCHRF 586 Shewanella one...
jgi:Sama_3253 513 KDT-ELKVSKQDLCQPWHYRKLVLVVNLEHDPTPDWPGQEVLVDIMNANLFSLGRKQLNMLGSLDVLSFNSWGEWHAHHF 591
jgi:Asuc_0361 533 PVH-ALPPTNDDLHHPCEIRQLMVAINLSNDPTKQ--LTDSKMPIQQSDLFSFGSEQQNLVGSIDFIYRNLWNEIRTLHF 609
jgi:HSM_1936  535 PITrTKKATNKELTRQCKIKHLSVTINLTNDPTAH--LLQSKSTILPSDLFSFGPSEESLVGSIDLTYRNIWNEIRTLHF 612
P40134        539 PSTiAKQPKNSDLLNQCEIRSLFIAINLTTDPTSK--VEEVLTGISSRDLFSFGSLEQSLVGSIDFTYRNVWNEIRTLHF 616 Haemophilus in...
Q05766        538 PVT-VSSVTNEDLTHACEIRSLIVAVNLTVDPTKK--ITQVKSRIQASDLFSFGPKEESLVGSIDITYRNLWNEIRTLHF 614 Pasteurella mu...
Q5E8T4        583 SGETAILDALKTVLCKMHQDAARPESVDVFCYSKQMRGIIRNNIYQLLAECIELRLKpvenNEKRRRFKGIKIGSTMYGL 662 Aliivibrio fis...
jgi:Fbal_3692 578 EEEEGLLKLLAQLLSGLDR-ANGPLAIEVFCAAKRLRSQIEDAMVQLLDRVQRLYCQt---TMERTQVWPLAIGHRQYGL 653
Q088L2        606 NGKTALLEAISFIILGLKR-SNEQVDLSIISCSAKLKQPIFNQLKTLLLRCYGLMKKv---NQTNTLMHPITIGEQHYSM 681 Shewanella fri...
BAJ03811      593 HGELAILEVLAFITPGIRR-SAENLHVEVVSGGARLKNQFEQTVRNLVRRVAHLSWKv---SPSSTLVYPLKVAKVRYGL 668
Q8E9H1        587 EGETAVLQALAFVTPGLRR-ATHPVDMDVISCSQRLRPQLKLAVKNLLKQTVRLCQQv---QQSSTLVQPLQISHTRYGI 662 Shewanella one...
jgi:Sama_3253 592 EGEQALLKAMTFLAPGIRR-AAGRLDLRTLGCSARLTFQLELAVHSLLKQVAKLSCQa---SASSTLVQPLRIGNRNYGL 667
jgi:Asuc_0361 610 EGPNAILMALKVLSNKIHHGSTALANIEVYSYSRNYRYSLANIVTALIKKCIDIQLGt---NQAANSQSMLRVAGKNWQF 686
jgi:HSM_1936  613 EGANAILLALKVLSNKFYPGSTPPKSINVFCYSQHYQKTLCNIVHALIKKYIDIRIG----DTDAPKNNMLRIAGKNWQL 688
P40134        617 EGQNAILLALKVLSNKIYRGVNRPDSIQVYCYSERYRQDLRQLVMGLVNRCVSIQVGd---IQQPCQTSRLRVAGKNWQL 693 Haemophilus in...
Q05766        615 EGPNAILLALKVLSNKIHRGAPSPKLIQVFSYSHRYRRTLSNIVTALINRCISIQIG----DALPPQNNLLRVAGKNWQF 690 Pasteurella mu...
Q5E8T4        663 FFERRGVSIQ--KLEDSVQFYSSISTNKAIGSTTIPLGD-------------NSGVVIPDAVDSFASEGLIQFFFDDSQn 727 Aliivibrio fis...
jgi:Fbal_3692 654 FIDPRGLRWQ--RLDKGAALLGQLRRHGVVELPKPDLGD-------------DPYAGAPAILGHYARKGLVQIFVRERP- 717
Q088L2        682 HFNSLGMMYRkvDLITGTGNFNS------SVLPYADLAE-------------DPYLNSPSVIQKFIVMGAKQYFLRERH- 741 Shewanella fri...
BAJ03811      669 FFNSKGMVYQ--DLKDAKAFYQQLTKSMLIELPRPNLGN-------------EPFTKVPAVIQDFAARGAIQYFLRQSD- 732
Q8E9H1        663 FFNPLGMAYQ--DLSDAKSFYQQLARSHLVQLPRPELGD-------------DPFSSMPNIIQNFAAKGAIQYFLRQRT- 726 Shewanella one...
jgi:Sama_3253 668 FFNTLGVAYE--DLADAPSIYKQMSRGHLLSIPRPELGD-------------DPFASVPELIQDYATEDVIQYFLRPRE- 731
jgi:Asuc_0361 687 FFEERGISLH--ELPENQELP----VNELDKELYAEINKndsvlpvryeqnmPEKLQYPSEIDSFASEGFLQFFFEDNSd 760
jgi:HSM_1936  689 FFEERGLSLQ--EMQNTS-----INNSVFDNELRNTIEEket-------allAEQKHYPYEMDAFASEGFLQFFFEDNEd 754
P40134        694 FFEDRGISLQ--EIGNESVCNEAESAVDFDEVLQTPIEDge---------tnQESRRYPPEMDAFASEGFLQFFFEDNSd 762 Haemophilus in...
Q05766        691 FFEERGISLQ--EIHSNEELE----ATGFDTALQTEVEEkes-------alpDTSRTYPPEIDHFASEGFLQFFFEDNSd 757 Pasteurella mu...
Q5E8T4        728 ddDGFNIYVLDEENKIEIYHQCYGSKDDMVNSINHYYTSSRNNEDLSNpDKV--NFNLPQFYEVVYGd-----TQEASIH 800 Aliivibrio fis...
jgi:Fbal_3692 718 --SGMDIYLLDEHNELKRLKSDSQGLDSLVDEFSHLYAFRRSNQRATFgAGG--CFNLPQFYRLSRDd-----DGELMVE 788
Q088L2        742 --QTLDVFIADDNNQLEHLQYQHTSINDFVAKESHLYVFDEQKQRSP-------VFNMPQFFQLVDI------EGKLTVI 806 Shewanella fri...
BAJ03811      733 --EDLDVFVLNENNELDHYIQKGTSVDELVSEVSHYHAFEEPDISTQ-------RFNLPQFFRLMRV------DGRLQVI 797
Q8E9H1        727 --DSLDVFILDEENQLSHYVQSGSDMSELVNKVSHHYVFDEFYASKA-------RFNIPQFFHLVRV------AGELTVR 791 Shewanella one...
jgi:Sama_3253 732 --EGIDVFILNHKNEISHYVQHGTTVEALVSKVSQQHAFEGLYEMHG-------RFNLPQFFQLVRM------QGELKAQ 796
jgi:Asuc_0361 761 --DTFNVYILDEKNHVEIYHRCDGEKEQKINEINYIYTNADSSGN-NPyGIIqqNFNYPQFYRIIHNryyegnNPPVHIV 837
jgi:HSM_1936  755 --KSFNVYILDEQNHIEIYRHCEGSKEQKIREINQIYQSASLDKNNNPyKIVqhNFNYPQFYQLLPDc-----NGGTKIV 827
P40134        763 --HSFNVYILDESNHLEIYRHCDGEKDEKVREINQLYQNAKQEGDKNPyNIVqhNFNYPQFYQLQNG------KNGISIV 834 Haemophilus in...
Q05766        758 --GSFNVYILDEANRIEIYRNCDGQKEKKILEINHIYQSSGLDENNNPyKIVqrDFNYPQFYQLLLQ------ENGVKIV 829 Pasteurella mu...
Q5E8T4        801 SYRSG 805 Aliivibrio fischeri ES114
jgi:Fbal_3692 789 PLai- 792
Q088L2        807 PFGLS 811 Shewanella frigidimarina NCIMB 400
BAJ03811      798 PFGVS 802
Q8E9H1        792 PFGVD 796 Shewanella oneidensis
jgi:Sama_3253 797 PVgmv 801
jgi:Asuc_0361 838 PFQRQ 842
jgi:HSM_1936  828 PFHSR 832
P40134        835 PFKFR 839 Haemophilus influenzae Rd KW20
Q05766        830 PFHSR 834 Pasteurella multocida subsp. multocida str. Pm70
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap