1I78,2X4M


Conserved Protein Domain Family
Omptin

?
pfam01278: Omptin 
Click on image for an interactive view with Cn3D
Omptin family
The omptin family is a family of serine proteases.
Statistics
?
PSSM-Id: 426174
Aligned: 11 rows
Threshold Bit Score: 316.987
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1I78_A                8 TPDNINADISLGTLSGKTKERVYLAeEGGRKVSQLDWKFNNAAIIKGAINWDLM-------PQISIGAAGWTTL-GSRGG 79  Escheric...
Q5ZSX9               27 EFNGLSLSASLGILSGKAHEYVYHP-ETDTKLSQLDWRIKNAPIIKGELNYDVL-------DWLSMNGQGWTTL-VKNKA 97  Legionel...
goetting:Loa_01388   35 HADKLSINTALGYLGGEANEYVYDE-DTHWKVSQLNWKIKRAAIIKGEINYDVL-------TWLTANASGWITL-TTGQA 105
2X4M_C               10 SPDSFTVAASTGMLSGKSHEMLYDA-ETGRKISQLDWKIKNVAILKGDISWDPY-------SFLTLNARGWTSL-ASGSG 80  Yersinia...
P06185               30 SPDSVTTSLSVGVLNGKSRELVYDT-DTGRKLSQLDWKIKNVATLQGDLSWEPY-------SFMTLDARGWTSL-ASGSG 100 Salmonel...
goetting:EBL_c18290  28 IPLNVTTGLALGTLSGEAKERVYDPeEGGRKISQLNWKYQNAAVIKGHIDWHIM-------PYLSLGASGWNTL-AGRGA 99 
Q326M1               39 IPDNISTDISLGSLSGKTKERVYHPkEGGRKISQLDWKYSNATIVRGGIDWKLI-------PKVSFGVSGWTTL-GNQKA 110 Shigella...
LANL:CH46_3900       31 TAGNVTVSTSLGLLNAESIESVYQSsEPNQKLSQLNWEANNTPIVKMDIAWDAL-------PRLTLTAKGWSTL-SSGQG 102
Q5E5F5               22 dKKDISLGLSLGVLNGASKELVYD--DTGRKLSQLDWRIDNVPIIKLETDWNIN-------QRWTLTGDFWSILiDDGNA 92  Aliivibr...
WP_015707856         36 TPYTFSLATGIGVLLGQAEEIVYQDdDDDAYLSKLLWDLKPMVYVGTALELSRThpldglgAEVDLSVKFGLPL---QSG 112 Treponem...
Q11MB3               38 QNEQFRFSVEAGYLTARANEYVY---EEGRTVSRLIWDINAAATITARAEMNMT-------PRWRLSGSATVGI--DHSN 105 Chelativ...
1I78_A               80 NMVDQDWMDSS-----NpGTWTDEARHPDTQLNYANEFDLNIKGWLLNEPNYRLGLMAGYQESRYSFTARGGSYIYSse- 153 Escheric...
Q5ZSX9               98 AMDDYDWLNPY-----Q-DTWTHWSHHEDTHLNYANELDMSLRAWLMQKQNYKLGLATGYQWNSFDWKATGGCYQYN--- 168 Legionel...
goetting:Loa_01388  106 SMDDYDWLNPN-----Q-INWTDWSHHENTDLRYANDIDFNLRGWVLQNNHLKLGMTTGYKRTSFSFLAKGGCFQYS--- 176
2X4M_C               81 NMDDYAWMNEN-----Q-SEWTDHSSHPATNVNHANEYDLNVKGWLLQDENYKAGITAGYQETRFSWTATGGSYSYN--- 151 Yersinia...
P06185              101 HMVDHDWMSSE-----Q-PGWTDRSIHPDTSVNYANEYDLNVKGWLLQGDNYKAGVTAGYQETRFSWTARGGSYIYD--- 171 Salmonel...
goetting:EBL_c18290 100 YMHDYDWEDAS-----Q-KSWTDHSWHPNTRLNNAYQFDLNATGWIFNQPDWRLGVMAGYQQSHYSFTARGGNYSYD--- 170
Q326M1              111 SMVDKDWNNSN-----TpQIWTDQSWHPNTHLRDANEFELNLKGWLLNNLDYRLGLIAGYQESRYSFNAMGGSYIYSen- 184 Shigella...
LANL:CH46_3900      103 VMDNYDWLTPQ-----Q-TQWSDWSHHEKTNLNYANEIDINAKIWFLKQHNYRVGPILGYQENNQSWTAYGGNFNYN--- 173
Q5E5F5               93 HMEDRDWFIEN-----Q-HFPTDISISPKTTLKKAYQASLHTTYWLFIQNNYEIGALGGFQYNQFKWEDLGGTYSYN--- 163 Aliivibr...
WP_015707856        113 VMEDRDWDDPLypashDdPLFTNFS-SSDAYIQGAVLADFSGGLTIPVAQAVVIKALFSFSFMRFSWIARDGYRRYK--- 188 Treponem...
Q11MB3              106 FMADYDWLTPS-------PDWSHRSVHWDTQLDHYVALDLGASYAAWQINRTTLNILGGLRYTDFQLSSYGGSFVYTted 178 Chelativ...
1I78_A              154 egFRDDIGSFPNGERAIGYKQRFKMPYIGLTGSYRYE---DFELGGTFKYSGWVESSDNDEHYDpkGR----ITYRSKVK 226 Escheric...
Q5ZSX9              169 --GGLYAGCFPGDQPGIGYQQKFRTPYVGLAGRYFIN---NFEFSGVLKFSDWVSARDHDEHYA--RN----LTFNERGN 237 Legionel...
goetting:Loa_01388  177 --NGTFIGCFPYNEPGLGYQQKFNTVYLGLAGNYSIN---NLEFNAVLKFSPWVWATDVDQHYL--RN----LTFKEHGD 245
2X4M_C              152 --NGAYTGNFPKGVRVIGYNQRFSMPYIGLAGQYRIN---DFELNALFKFSDWVRAHDNDEHYM--RD----LTFREKTS 220 Yersinia...
P06185              172 --NGRYIGNFPHGVRGIGYSQRFEMPYIGLAGDYRIN---DFECNVLFKYSDWVNAHDNDEHYM--RK----LTFREKTE 240 Salmonel...
goetting:EBL_c18290 171 --NGSDVGEEDPRVKGISYQQNFKMPYIGLTGSYTYS---NIELAGAFKYSGWVRSADTDHHHL--TS----TLFNGKIR 239
Q326M1              185 ggNRNKKGAHPSGERTIGYKQLFKIPYIGLTANYRHE---NFEFGAELKYSGWVRSSDTDKHYQ--TE----TIFKDEIK 255 Shigella...
LANL:CH46_3900      174 --NGANIFTAPDGIVGVGYKQKFDMLYIGLAGSYRYQ---QLEFNALLKYSNWVNANAYDNHYN--RK----VSFKDSSK 242
Q5E5F5              164 --NGTDVGTFP-DVVGIDYKQEFGMFYAGLTGKYRLD---NSEFSFLLKLSPWVKAKDVDNHYL--RN----LTFYEKSN 231 Aliivibr...
WP_015707856        189 ---AEDWEKIPGQGIMISYDQNWLIFSPGLGLSWPFHplmGLDFNFFI--SPLIIAFDMDNHYLniRSgkeyTQYVDTMP 263 Treponem...
Q11MB3              179 geFRGDSLSFPDGQAVITYRQRLPALYGGLGASRQIG---SVHFDAGILGGVTLWPRDKDHHWL--RS----LKFKDEFK 249 Chelativ...
1I78_A              227 D-QNYYSVAVNAGYYVTPNAKVYVEGAWNRVTNKKGNTSLYDHNNNTS-DYSKNGAGIENYNFITTAGLKYTF 297 Escherichia col...
Q5ZSX9              238 S-SRYYAATIHSGYFLKPNTKIFVEASYNHYPNGRADTEIIDNDTGER-SYFGDSAGLSNKHYTVALGLQYLF 308 Legionella pneu...
goetting:Loa_01388  246 N-SNFYSAGIMAGYYITHHTKIFAEATYNRFTNGKADTEIVDNRDGTY-TYLNNTAGLGNKNYSLAIGIQYRt 316
2X4M_C              221 G-SRYYGTVINAGYYVTPNAKVFAEFTYSKYDEGKGGTQTIDKNSGDSvSIGGDAAGISNKNYTVTAGLQYRF 292 Yersinia pestis
P06185              241 N-SRYYGASIDAGYYITSNAKIFAEFAYSKYEEGKGGTQIIDKTSGDTaYFGGDAAGIANNNYTVTAGLQYRF 312 Salmonella ente...
goetting:EBL_c18290 240 N-QNYYGLEGSIGYWVTPQAKIALNTAWTRVANKKGSIKAHNYDEDTL-ARANNASGIEHYNLVTSVGLSYRF 310
Q326M1              256 N-QNYRSVAANIGYYVTPSAKFYIEGSRNYISNKKGDTSLYEQSTNIS-GTIKNSASIEYIGFLTSAGIKYIF 326 Shigella dysent...
LANL:CH46_3900      243 N-SSYYSAVIDVGYYFTENTKLFVEAAWNQYSEGRGETQTLNYATG---NVGSSKSGIEYQSQTLTVGFQYKF 311
Q5E5F5              232 EySDAVSLSINYNYNFGPNMNLYTEYAYTRYFEANADMTKVNNKTNDS-SFSENAAGLDNLYSTLSIGLKYSF 303 Aliivibrio fisc...
WP_015707856        264 G-GLYIEPSLDFRFSPTPIISLLLHSSWRYISGSRGDTTETVSGRNTPaTVYENSAGAAYSA--------FDL 327 Treponema primitia
Q11MB3              250 R-SPYLALQLRASVPVSDKGEAFLSARFEKYFRMEGNTHILDTRTGQS-SLFQDSAGASLQALNIGVGLRFRF 320 Chelativorans s...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap