3CCJ


Conserved Protein Domain Family
Ribosomal_L21e

?
pfam01157: Ribosomal_L21e 
Click on image for an interactive view with Cn3D
Ribosomal protein L21e
Statistics
?
PSSM-Id: 426087
Aligned: 154 rows
Threshold Bit Score: 96.0091
Created: 26-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3CCJ_Q                1 MPSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTV--EGKQGDAYKVDIVD 78  Haloarcu...
WGS:AFBI:EDEG_01292   1 -MKRNGFCRNTRKKFKKDLRKKGVPNITSLLQVYKNNDYVDIKINSAYNKSMPHKIYHGRTGKVykVDERTIGVKVKRVS 79  Edhazard...
EHY65329              1 -MRSKGYRSKTRSVFKKDYDQSKRPQTTTLLNQYKRGDYVDISVDSGVHKGMPHRTFVGKTGRVyaVFKTSVGIALTKQC 79  Nematoci...
EEQ82204              1 -MSAGGYRRKTRQLLKQPFRKHGTPGLSVYLATYRIGDYVTININPSIHKGMPFKYYHGRTGRVftVNPKSVGVVLHKKV 79  Nosema c...
EOB13471             38 QMSSHGFRRKTRQILRKDHRKHGMPGASKYLQTFKMGDYVTIMIDSAIHKGMPHKYYHGRIGKVytVNPRSIGVVLHKRV 117 Nosema b...
EED44150              1 -MRSKGYRRGTRSLFSKGQKEHGNPTLTKTIQQFRIGDLVDIKIDPSVVKGMPHKYYHGKTGRIfnINNRSVGIILYRCV 79  Enterocy...
Q8SRW8                1 -MRSKGYRRGTRYLFSQDHRKHGVAHVSKYLEKYEIGDMVDILVNPAMMKGMPHKYYHGRTGRVydVKPRSLNVALYKRV 79  Encephal...
ELQ74124              1 MTSSKGYRRQTRKRFSQPFRKHGMPSISTYLTTYKRGDYVDIKVNPAVHKGMPHKYYHGLTGKVavVHKNSLTVRCTRRF 80  Trachipl...
EPR79136              1 MVSSHGYRRQTRNLFSQAFRKHGMPNTSTYLTQYAVGEYVDIKVNPAIHKGMPHKYYHGRTGIIkeVNRGSVIVLFNRIL 80  Spraguea...
A0C0D0                1 MTHSYGLKKGTRSKFAKPFRGHGNISIRKTLQTFKRGDFVDILVDGAQHKGVPFQYYHGRTARVfnVNPRGIGVSLQRRV 80  Parameci...
3CCJ_Q               79 GGK--EKTIIVTAAHLRRQE 96  Haloarcula marismortui
WGS:AFBI:EDEG_01292  80 GNReyEDKIDVRKEHLRLSK 99  Edhazardia aedis USNM 41457
EHY65329             80 GNSlvVKKVIARIEHVRPSQ 99  Nematocida sp. 1 ERTm2
EEQ82204             80 NGRlsVKTIFVRVEHLKRYK 99  Nosema ceranae BRL01
EOB13471            118 GGKyvVKTLFVRQEHLVKFK 137 Nosema bombycis CQ1
EED44150             80 GHKfiERHVNARVEHLTLSR 99  Enterocytozoon bieneusi H348
Q8SRW8               80 RGKyvIKKIIVRIEHVRKSR 99  Encephalitozoon cuniculi GB-M1
ELQ74124             81 GNKriHRMIVCRVEHLRKSK 100 Trachipleistophora hominis
EPR79136             81 ANKtvERKVIVGIEHIRKSK 100 Spraguea lophii 42_110
A0C0D0               81 RGRyvEKRFHVRADHLRPSK 100 Paramecium tetraurelia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap