Conserved Protein Domain Family
MSA_2

?
pfam00985: MSA_2 
Merozoite Surface Antigen 2 (MSA-2) family
Statistics
?
PSSM-Id: 144541
View PSSM: pfam00985
Aligned: 5 rows
Threshold Bit Score: 210.522
Threshold Setting Gi: 112931
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q03994 132 TTTTTTTNDAEASTSTSSenrnhnNAETNPKGKGEVQKPNQANKETQNNSNVQQDSQTKSNVPRTQDADTKSPTAQPEqa 211 Plasmodium falciparum...
O15867 105 SASTSTTNNGESQTTTPT------AADTPTATESISPSPPITTTESSKFWQCTNKTDGKGEESEKQNELNESTEEGPK-- 176 malaria parasite P. f...
P19599 105 SASTSTTNNGESQTTTPT------AADTPTATESISPSPPITTTESSKFWQCTNKTDGKGEESEKQNELNESTEEGPK-- 176 Plasmodium falciparum...
P50498 102 TTTTTTTNDAEASTSTSSenpnhkNAETNPKGKGEVQEPNQANKETQNNSNVQQDSQTKSNVPPTQDADTKSPTAQPEqa 181 Plasmodium falciparum...
Q03646 178 TTTTTTTNDAEASTSTSSensnhnNAETNPKGNGEVQ-PNQANKETQNNSNVQQDSQTKSNVPRTQDADTKSPTAQPEqa 256 Plasmodium falciparum...
Q03994 212 ensAPTAEQTESPELQSAPENKGTGQHGHMHGSRNNHPQNTSDSQKECTDGNKENCGAATSLLNNSSNIASINKFVVLIS 291 Plasmodium falciparum...
O15867 177 ---APQEPQTAENENPAAPVNKGTGQHGHMHGSRNNHPQNTSDSQKECTDGNKENCGAATSLLSNSSNIASINKFVVLIS 253 malaria parasite P. f...
P19599 177 ---APQEPQTAENENPAAPENKGTGQHGHMHGSRNNHPQNTSDSQKECTDGNKENCGAATSLLSNSSNIASINKFVVLIS 253 Plasmodium falciparum...
P50498 182 ensAPTAEQTESPELQSAPENKGTGQHGHMHGSRNNHPQNTSDSQKECTDGNKENCGAATSLLNNSSNIASINKFVVLIS 261 Plasmodium falciparum...
Q03646 257 ensAPTAEQTESPELQSAPENKGTGQHGHMHGSRNNHPQNTSDSQKECTDGNKENCGAATSLLNNSSNIASINKFVVLIS 336 Plasmodium falciparum...
Q03994 292 ATLVLSFAIFI 302 Plasmodium falciparum TAK 9
O15867 254 ATLVLSFAIFI 264 malaria parasite P. falciparum
P19599 254 ATLVLSFAIFI 264 Plasmodium falciparum FC27/Papua New Guinea
P50498 262 ATLVLSFAIFI 272 Plasmodium falciparum 3D7
Q03646 337 ATLVLSFAIFI 347 Plasmodium falciparum Nig32/Nigeria
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap