Conserved Protein Domain Family
Arteri_Gl

?
pfam00951: Arteri_Gl 
Arterivirus GL envelope glycoprotein
Arteriviruses encode 4 envelope proteins, Gl, Gs, M and N. Gl envelope protein, is encoded in ORF5, and is 30- 45 kDa in size. Gl is heterogenously glycosylated with N-acetyllactosamine in a cell-type-specific manner. The Gl glycoprotein expresses the neutralisation determinants.
Statistics
?
PSSM-Id: 109986
View PSSM: pfam00951
Aligned: 11 rows
Threshold Bit Score: 116.402
Threshold Setting Gi: 138776
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
A0FJB2    25 LA-VLVNaSNNNSSHIQ-LIYNLTLCELNGTNWLAQKFDWAVETFVIFPVLTHIVSYGALTTSHFLDTVGLATV-STAGY 101 Porcine reproductiv...
Q8QQU8    28 SW-SFVD-GNDSSSTYQ-YIYNLTICQLNGTESLSTHFDWAVDTFVLYPGCHSIFFHWVISQQANFLMRSASALcPLQDL 104 Porcine reproductiv...
ABC75711  28 SW-SFVD-GNDSSSTYQ-YIYNLTICELNGTESLSSHFDWAVETFVLYPVATHILSLGFLTTSHFFDALGLGAV-STTGF 103 Porcine reproductiv...
Q8QQU7    28 SW-SFAD-GNGNSSTYQ-YIYKLTICELNGTEWLSTHFDWAVETFVLYPVATHILSLGFLTKSHFFDALGLGAV-STTGF 103 Porcine reproductiv...
APP93785 111 QS-LLSNcSTCFTHLSScFLHTYTGHHINNTRLL-------LETYLAVPLLTHLLSYKFATTASFLDFAFFAGL-SITAY 181 Simian hemorrhagic ...
P28991     1 MG-AIDS--------------------FCGDGILGEYLDYFILSVPLLLLLTRYVASGLVYVLTALFYSFVLA--AYIWF 57  Equine arteritis vi...
P0C781     1 MG-GLEF--------------------CDQTSWYQIFIAFSLTYTPIAIYSLKVFRGTLAGIVNIFIFINCCVSfVYLMY 59  Lactate dehydrogena...
AGL08418   1 MGsSLDD------------------FCNDSTAPQKVLLAFSITYTPVMIYALKVSRGRLLGLLHLLIFLNCAFTfGYMTF 62  Porcine reproductiv...
O55479     1 MG-GLDD------------------FCFDHTAAQKLVLAFSITYTPIMIYALKVSRGRLLGLLHILIFLNCSFTfGYMPY 61  Porcine reproductiv...
ABL14272  81 NN-TYAVpVSTVLEQAH-GPYSTLFDDMPPFIYYGREFGIFVMDVFMFYPVLVLFFLSVLPYATLILERCVSILfVVYGL 158 Equine arteritis virus
Q06501    41 LS-TENAcVAGDSSTKN-LIYTSTLCELNVTG-FQQHFGYAVETFVIFPAVTHLISLKFLTTAHLLDFLSLGVV-AGGGY 116 Lactate dehydrogena...
A0FJB2   102 YHGRYVLSSIYAVCALAALIC----FVIR----LA--KNCMSWRYSCTRYTNFLLDTKGR--LYRWRSPv-IVEKGGKVE 168 Porcine reproductiv...
Q8QQU8   105 LARRYVLKKMYGACAFPALVF----FVIR----AD--KNCMACPYARTRFTNFPVDDRGR--NHRWKSP--MVEKLGKAE 170 Porcine reproductiv...
ABC75711 104 VGGRYVLSSVYGACAFAALVC----FVIR----AA--KNCMACRYARTRFTNFIVDDRGR--IHRWKSPi-VVEKLGKAE 170 Porcine reproductiv...
Q8QQU7   104 VGGRYVLTSVYGACALPALVF----FVIR----AA--KIAWLGATPAPGSPTLLWTTGGT--IHRKVSPi-VVEKLGKSE 170 Porcine reproductiv...
APP93785 182 ---RYVSPAILFFLPL-ALIFsa-iFIKK----LV--VNCMALRFAWTRHTNFIIDDRGR--LFVNHDDv-LISDPQGLR 247 Simian hemorrhagic ...
P28991    58 VIVGRAFSTAYAFVLLAAFLLlvmrMIVGm---MPrlRSIFNHRQLVVA--DFVDTPSGPvpIPRSTTQv-VVRGNGYTA 131 Equine arteritis vi...
P0C781    60 -HHSVTNTIALSLGAVIALVWgiytLVKIvdwlVIrcRLCFLGRSYILAPPSHVDTSDGRqsLTTSLTTafVVRKPGSTL 138 Lactate dehydrogena...
AGL08418  63 VHFESTNRVALTMGAVVALLWgvysAIETwkfiTSrcRLCLLGRKYILAPAHHVESAAGFhpIAANDNHafVVRRPGSTT 142 Porcine reproductiv...
O55479    62 VHFESTNRVALTLWAVVALLWgiysFTESwkfiTSrcRLCCLGRRYILAPTHHVESAAGLhsIPASGNRayAVRKPGLTP 141 Porcine reproductiv...
ABL14272 159 ------YSGAYLAMGIFATTLvvhsLVVL----RQllWLCLAWRYRCTLHASFI-SAEGK--IYPVDPGlpIAAAGNRML 225 Equine arteritis virus
Q06501   117 WHQQYVVSSIYASCALLAFIF----FCCR----AV--RNCMSWRYKCTRFTNFVLDTKGR--VFRNRSSv-LVEQHGKVL 183 Lactate dehydrogena...
A0FJB2   169 VEGHLI-DLKRVVLDGSAATPLTRVSAEQWG 198 Porcine reproductive and respiratory syndrome virus
Q8QQU8   171 VGGDLV-AIKHVVLEGVKAQPLTRTSAEQWK 200 Porcine reproductive and respiratory syndrome virus
ABC75711 171 VGGDLV-AIKHVVLEGVKAQPLTRTSAEQWE 200 Porcine reproductive and respiratory syndrome virus
Q8QQU7   171 IDGDLV-TIKHMVLEGVKAQPLTRTSAKQWE 200 Porcine reproductive and respiratory syndrome virus
APP93785 248 VGPHKV-RAAKVILGGREANLLRQAHVEEWS 277 Simian hemorrhagic fever virus
P28991   132 VGNKLVdGVKTITSAGRLFSKRTAATAYKLQ 162 Equine arteritis virus Bucyrus
P0C781   139 VNGQLVpDFQRLVLGGKKAVSKGAVNLLKYV 169 Lactate dehydrogenase-elevating virus
AGL08418 143 VNGTLVpGLKSLVLGGRKAVKQGVVNLVKYA 173 Porcine reproductive and respiratory syndrome virus
O55479   142 VNGTLVpGLRSLVLGGKRAVKRGVVNLVKYG 172 Porcine reproductive and respiratory syndrome virus
ABL14272 226 VPGRPT--IDYAVAYGSKVNLVRLGAAEVWE 254 Equine arteritis virus
Q06501   184 LQGQPI-EVKTVVLDGVKAVRAKTVPAEKWE 213 Lactate dehydrogenase-elevating virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap