4B4A


Conserved Protein Domain Family
TatC

?
pfam00902: TatC 
Click on image for an interactive view with Cn3D
Sec-independent protein translocase protein (TatC)
The bacterial Tat system has a remarkable ability to transport folded proteins even enzyme complexes across the cytoplasmic membrane. It is structurally and mechanistically similar to the Delta pH-driven thylakoidal protein import pathway. A functional Tat system or Delta pH-dependent pathway requires three integral membrane proteins: TatA/Tha4, TatB/Hcf106 and TatC/cpTatC. The TatC protein is essential for the function of both pathways. It might be involved in twin-arginine signal peptide recognition, protein translocation and proton translocation. Sequence analysis predicts that TatC contains six transmembrane helices (TMHs), and experimental data confirmed that N- and C-termini of TatC or cpTatC are exposed to the cytoplasmic or stromal face of the membrane. The cytoplasmic N-terminus and the first cytoplasmic loop region of the Escherichia coli TatC protein are essential for protein export. At least two TatC molecules co-exist within each Tat translocon.
Statistics
?
PSSM-Id: 459989
Aligned: 633 rows
Threshold Bit Score: 69.7671
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4B4A_A             5 EHLRELRYRLII--SIIAFLIGSGIAFy---FakyvFE-----ILK--------------------EPil--kSy----- 47  Aquifex aeo...
jgi:Ilyop_2288    15 EHLKELRKKLII--SVISFAIFVVVA-----------------FAIhnqivdlfikfyssipsggeNKlfv--------- 66 
WP_013925759       7 DHVEELRKTLLR--CLFSIGVGFLLCl---lAykplLH-----FLI--------------------QPlqssqWtetsiv 56  Parachlamyd...
unil:wcw_0020     19 GHVDALRSTLIRvlATIALAMSVVLF----------FHrpiidFFT--------------------SPlessaIktesit 68 
Q1XGC2             7 tILKEVRIRFFW--IFICFSLTWFTCywfs---edlFFssaksFLIlsys------------------------------ 51  Physcomitre...
jgi:MicpuN_mit54  13 qFMQELFWKSIY--TCLSLAFCFCICFsyadV-----------FLFhyaavcfkv------------------------- 54 
BAL01544          20 gHLRELRNRILV--CVLALFVCCAVFLy---YakwfVD-----RLT--------------------Dmgkay-------- 61 
jgi:Spirs_1140    11 EHLSELRKRLFY--IAISIVLFSGIGYy---FvepaVE-----VLK--------------------KPaqgl-------- 52 
jgi:Amet_0999     10 NHLDELRKRVII--ISLAIIVGSLVSYa---YidliID-----LIV--------------------KPaknl-------- 51 
jgi:Clos_2137     13 EHLGELRKRLII--AAIAIIAGSLASYn---YvdkiIE-----ILV--------------------RP-----A------ 51 
4B4A_A            48 ----------------------------------------------------PeveliTLSPTEPLFILIKISLAVGFII 75  Aquifex aeo...
jgi:Ilyop_2288    67 --------------------------------------------------nsI---------VEGMTTKIKISLITGLIL 87 
WP_013925759      57 rkkltnstqqdqvvhltpdmmvapsfanesikqnastyvvpagqsividivqNgskliLTSPLEGISTVVKLSFWFGLAG 136 Parachlamyd...
unil:wcw_0020     69 qskitntssnpvsyylqh-----------dnrylvlapnesltvtethppklA-----IFSPSEGLTTILKVCFWVGAAS 132
Q1XGC2            52 -------------------------------------------------------gfiCTQLTEALSTYVTISLISCFYF 76  Physcomitre...
jgi:MicpuN_mit54  55 -------------------------------------------------lpniipsflTLDVTEALQSMILISIYICSMC 85 
BAL01544          62 -----------------------------------------------------gyvyvYLSPQELLIEYFQVTLIASVCV 88 
jgi:Spirs_1140    53 -------------------------------------------------------tfvYLTPPELFLAYIKISVTMGIIA 77 
jgi:Amet_0999     52 -------------------------------------------------------efiYLSPPELFLAYVKISLAVGAMI 76 
jgi:Clos_2137     52 ----------------------------------------------------DglefiYLSPPELFISYIKISLVVGIVV 79 
4B4A_A            76 ASPVILYQFWRFIEPALYSHEKRAFIPLLLGSILLFXLGALFAYFIV--L--PLALKFLLglgftQLLAtp---yLSVDX 148 Aquifex aeo...
jgi:Ilyop_2288    88 SMPLHLYNIVAFIFPALNKKEKMCLAAALVCSFVLVIVSIYLSYFKI--L--PISIKFLTdsdfip---qdvgllLNYNT 160
WP_013925759     137 SSPLWIWYILRFISPALSINKQRLLLKAFFLTIALFGLGVYVAYRLT--I--PLANAYFMh---fNqglg--inlWSLSS 207 Parachlamyd...
unil:wcw_0020    133 SAPIWLYWIYLFVAPALHTSEKRLFIPFALFSLCFSLLGVTFCYLFT--I--PIANQYLNgfnak-----lgmnvWGLEH 203
Q1XGC2            77 LFPFLSYQIWCFLIPSCYEEQRKKYNKFFYLSGFCFFLFFFVTFVGV--V--PNVWHFLYelnktstnlliiklqPKIFD 152 Physcomitre...
jgi:MicpuN_mit54  86 LFPIIYYFILTFILPSCFETEIQYIYILSIGSI----LSSILAYVVTmhLlvPNVIHFFLyldtnma--ptwhhvPRLIH 159
BAL01544          89 CLPLLLYQLWAFARPGLSKSENLTVVLCLFFGLFCFAGGLYFAYRII--L--PFMLAFLig---vNSAGsgisasISVQN 161
jgi:Spirs_1140    78 SVPVILFQIWRFVKPGLEKREVAALGFTIIFGTIFFITGAFFSYRII--L--PITLTFFLkystpE--Ita---mFSFGN 148
jgi:Amet_0999     77 ASPIVLVQIWLFIKPGLKKRERKYLLFALFMGIVFFAMGTSFAYFII--I--PMTIDFFVkmavdG--Iap---lFSFAN 147
jgi:Clos_2137     80 SAPIVLFQIWMFIRPGLKEKEQRYVLFAMFMGIVFLVMGVVFAYFII--I--PMTIQFFVkmtvnG--Iep---lFSFAN 150
4B4A_A           149 YISFVLKLVVAFGIAFEXPIVLYVLQKAGVITPEQLASFRKYFIVIAFVIGAIIAP-DVSTQVLXAIP 215 Aquifex aeolicus
jgi:Ilyop_2288   161 NLFYALYFVFWSIIGFQSPIVFVLLMAFNIVKRKTALAASRYIIVFIFIISAVVTPpDVVSQVGLALP 228
WP_013925759     208 YLEYTIILMLGNGLAFEGGAILLLLVQGGVISQNTMRKYRRHAIVGIFLLSAILTPpDVLSQILLAVP 275 Parachlamydia acanthamo...
unil:wcw_0020    204 YLNYTLILLAANAIAFEACVALFFLVHYGKISEKGMSKYRKHVIVSIFTLSAILTPpDVFTQVMMALP 271
Q1XGC2           153 YILLTVRILFISSICSQVQVLVIFLLESKGIFVKSCIKNRRFFMVLSIFTAAFLTPpDIWCQIVACll 220 Physcomitrella patens
jgi:MicpuN_mit54 160 YISFIITFSIAMQIVSQLPWISLILYKIWPFPIQVFNTIRKYIHVGALCISAFLCPpDLYLQLYLWVv 227
BAL01544         162 YINFLLTVFIIFGCIFEMPMVSVLLTRFGILKPQIMRKARKAVVVIIFLIAAVITPpDIFSQVMVAVP 229
jgi:Spirs_1140   149 YIGFISSIMIAFGVAFELPIVVVILTRVGLVNHKKLQQAAKYILLGIVVMAAILTPpDVVSQILLAGP 216
jgi:Amet_0999    148 YISFCSSLLFSFGLVFQLPLLIILLSQLNLVSSKTFKGYRKIFVLLIFIVAAVLTPpDVVSQVLMAGP 215
jgi:Clos_2137    151 YISYISSILISFGVVFELPLIVILLTQLGLATPATFKKHRKMVILGIFVVSAILTPpDVVSQSMMALP 218
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap