6SKF,4A18,5XY3


Conserved Protein Domain Family
Ribosomal_L39

?
pfam00832: Ribosomal_L39 
Click on image for an interactive view with Cn3D
Ribosomal L39 protein
Statistics
?
PSSM-Id: 425894
Aligned: 80 rows
Threshold Bit Score: 30.624
Created: 26-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6SKF_Bi      10 KLRLAKAAKQNRRVPVWVIVKTNRKVITHPKRRHWRRTKLK 50 
CDS38355     10 KTKLGKKLKQNRTLPYWARARTGNRIRYNAKRRHWRRTKLK 50  Echinococcus multilocularis
1_pfamImport  1 --KLAKKLKQNISVPC-VRLRTKNTIRYNAKRNHWRRTKFK 38 
Q4DVC6       10 KKKYAKKLKQNRPVPYWIRLRTGNRIKWNEKRRHWRRTKLH 50  Trypanosoma cruzi
EHY64719     10 KRRLIKANRVNKPVPAWKRLIPGNKQHYNTKRRHFLRTKLK 50  Nematocida sp. 1 ERTm2
EPR79223     10 KVQLVSALKKNRCIPQWKRACPGFKQQYNFTKRSWKRKTLK 50  Spraguea lophii 42_110
ELQ74568      9 KIRLAKALKKNRSIPPWKRELKHNKQEFNFKKRSWRRNKLK 49  Trachipleistophora hominis
Q8SQP8       10 KTRLMRALKRNREIPAWKRMMKEHKGEYNRARRHWRSKKLK 50  Encephalitozoon cuniculi GB-M1
XP_007604485 10 KRRLAKAFRMNQAVPAWKRETLSPRDGYNFKRRNWRSTKLK 50  Vittaforma corneae ATCC 50505
XP_001319449 10 KRILCKAMKVNRPMPQFIRQMTGVRHIRNPLTRHWRRRKMN 50  Trichomonas vaginalis G3
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap