4GIC,1K75


Conserved Protein Domain Family
Histidinol_dh

?
pfam00815: Histidinol_dh 
Click on image for an interactive view with Cn3D
Histidinol dehydrogenase
Statistics
?
PSSM-Id: 425883
Aligned: 571 rows
Threshold Bit Score: 357.803
Created: 26-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4GIC_B          28 SESEDT-DIHQ-RVTEIIGCIRRDGDAALVELTARFDHFv--Vdtaa----aleLPRDVleaaWQALPAEQAKALREAAE 99  Methylococcus...
WP_011524483    20 GMADAS-RVEP-VVRKIVVDVRKNGDAALRRYASKLDGLgkta--------alrVSTEElksaWDATRSEFKQAIRAAAK 89  Candidatus Ko...
WP_015897430    25 SEASYE-RALP-AAQRIVQGVRRGGDAALLRYRAKFDGIaase--------plrIPAEEmeaaWKATTAELKAALKQAAK 94  Acidobacteriu...
jgi:Terro_3621  25 GAVKTA-EVEP-TVRKIMQEVQKKGDKALLKFAEKFDslqg----------hlrVTAGEmldaWNATPEPLQQAMQIAAE 92  Terriglobus r...
jgi:AciX9_3063  25 GATNTA-RVEN-TVSTILADVRQGGDEAVMEYAARFDGLqciNgksq----pllVTREEmkaaWDDTDATLREAMEIAQA 98  Granulicella ...
WP_013569553    25 GASNTA-KVDT-TVRTILADIRHGGDASLIEYAGRLDGLrlgCpekgepdqsfrVTREEmlaaWNDTEPALQAAMRLAQA 102 Terriglobus s...
WP_014264239    25 GAANTA-KVDG-VVREILAAVRERGDAALHEYTARFDGLaaeq--------pllVSREEmqsaWEATSEELKAAMRLAQA 94  Granulicella ...
WP_012258552    21 PLDDDA-ATTT-AVAGIIAGVRQRGDAALREYTQRFD-----Gvdra----tleIPRERwaaaAADLDPALRHALLLAIG 89  Chloroflexus ...
WP_013177847    22 QGPDSA--AHEeAVRAILARVRAEGDAALFDLTERFDgvrl---------galqVPEAAfaaaEREVPAALQDAMRLSAA 90  Truepera radi...
Q5SKC1          15 RGLSFDpTVEE-IVRGILEAVREEGDEALDRFSRDLDgyp-----------veeVPKRAwreaYEDLDEDLRDALETARE 82  Thermus therm...
4GIC_B         100 RIRAYAERQKLDSWDyREADGTLLGQKITPLDRVGLYVPGGKAAYPSSVLXNAVPAKVAGVPELIXAVPa--pRGELNAL 177 Methylococcus...
WP_011524483    90 NIERFARWQMPksWTrDAGDGIELGQIIRPIESVGCYVPGGRYPLPSTVLMTVVPARVAGVERVVVVSPnp------aRE 163 Candidatus Ko...
WP_015897430    95 NIRRFAQKQRPrdFTlQMAPGVTAGQKVIPLEAVGCYVPSGRYPLPSTLLMTAIPAQVAGVRRIVAVSPrp------aKE 168 Acidobacteriu...
jgi:Terro_3621  93 NIRSFAEQQKPdeWTtENTPGVTVGQIIRPLESVGCYVPGGRYPLPSTLLMTTIPAKVAGVERIVVCSPkp------aRE 166 Terriglobus r...
jgi:AciX9_3063  99 NIRAFAEAQKPgeWTiEPAAGVQTGQIVRPLGSVGCYVPGGRYPLPSTLIMTVTPAQVAGVARIVVCSPkp------aKE 172 Granulicella ...
WP_013569553   103 NILAFAERQLPkpFSfRPVEGMEVGQIVRPLSSVGCYVPGGRYPLPSTLLMTATPAQVAGVKRIVVCSPkp------aKE 176 Terriglobus s...
WP_014264239    95 NIRTFAEKQLPraWSfRPSEGMEVGQIVRPLSSVGCYVPGGRYPLPSTLLMTVTPAQVAGVERIVVCSPkp------aRE 168 Granulicella ...
WP_012258552    90 EIRRFHERQLRNSWVeFSVEG-ALGQLVRPLDRVGLYVPGGAAPLPSSLIHAAVPARVAGVREIVVCSPpqrsTGEPAEV 168 Chloroflexus ...
WP_013177847    91 RIRAFYERQPq-eGFlYPAEGGLLGQLVRPVTRVGVYAP---AALFSTLLMCAVPAQVAGVREIAVATPpr-gDGRVAPE 165 Truepera radi...
Q5SKC1          83 RIEAFYREEAr-gGFlRAEGGGVLAQLVRPLERVGVYVPGGSAPLLSTLLMTVVPAKVAGVREVIVASP-----PKVHPG 156 Thermus therm...
4GIC_B         178 VLAAAYISGVDRVFRIGGAQAVAALAYGTETVPRVDKIVGPGNIYVATAKKLVFGQVGIDXVAGPSEILVISDGRTDPDW 257 Methylococcus...
WP_011524483   164 TLAAAYLLGVGEFYRIGGAQAVAALAYGTESVERVAKIVGPGNIFVTTAKKLVAFDCAIDMLAGPTEAAIVSER-GNARF 242 Candidatus Ko...
WP_015897430   169 TLAAAHMLGVAEFYRIGGAQAVAALAYGTASIERVGKIVGPGNAYVTAAKKAVSFDCGIDMLAGPTEIVIASEN-GTVEG 247 Acidobacteriu...
jgi:Terro_3621 167 TLAAAHLAGVTEMYRTGGAQAIAAMAYGTETIARVAKIVGPGNLYVTAAKIIASTECGIDMPAGPTEIVVTSQV-GDAAG 245 Terriglobus r...
jgi:AciX9_3063 173 TLAAGWLCGVTEFYRMGGAQAVAAMAFGTQTIGRVEKIVGPGNLYVTAAKAAVSHECGIDMPAGPTEIGVMSEH-GDPAG 251 Granulicella ...
WP_013569553   177 TLAAAHLAGITEFYRIGGAQAIAAMAYGTETIKPVDKIVGPGNLYVTAAKIAVSHECGIDMPAGPTEIVYTSEI-GNPAG 255 Terriglobus s...
WP_014264239   169 TMAAAYLAGVTEFYRVGGAQAIAAMAFGTATIAAVDKIVGPGNLYVTAAKIAVSQETGIDMPAGPTEIVVTSEN-GDPSG 247 Granulicella ...
WP_012258552   169 VMAAAHLAGVDRLFAVGGAQAIAALAYGTESVPRVETIAGPGNRYVIQAMRLVYGTVGIVSLPGPTETLIIADHTASPRA 248 Chloroflexus ...
WP_013177847   166 ILVAARLLGLTEVYAVGGAQAIGALAYGTESVPRVDKIVGPGNAYVVLAKRLVFGEVGIEALPGPTETLVLADESAEAHH 245 Truepera radi...
Q5SKC1         157 VLAAAWVAGADRLFAMGGAQAIAALAYGTGRVPRVDKIVGPGNRYVVAAKRLVYGTVGIDGLAGPTETMIIADGSASPRL 236 Thermus therm...
4GIC_B         258 IAXDLFSQAEHDEDAQAILISPDAAHLEAVQASIERLLPGXER--A-EVIRTSLERrGGXILVDDLEQAAAVANRIAPEH 334 Methylococcus...
WP_011524483   243 IAADLVAQAEHDPETMVAFFTTSPSLADAVKKQV----ALLAA--KnTIARKALATrGYIFVAQDIAQAMEAANQFASEH 316 Candidatus Ko...
WP_015897430   248 IAADLVAQAEHDPDAIAILVTSNAALGRAVAAKTKLRAQ---S--N-AIAKQSIAAnGAVILTRDVEEARMLTNQLAAEH 321 Acidobacteriu...
jgi:Terro_3621 246 IAADLVAQAEHDPETLAVLVTADSQLAKQVVNEVKEQAK---N--N-KLAQVSIKArGTIFLCGSVEEARFITNRLAPEH 319 Terriglobus r...
jgi:AciX9_3063 252 IAADLVAQAEHDPETLAVLITPSETLAEAVLAEVKQQAK---A--N-EIAEQSLTAqGAIFVTKTVTEAQDLTNRLAFEH 325 Granulicella ...
WP_013569553   256 IAADLVAQAEHDPEALAILITTREDLAKQVIAEAERQSA---D--N-EIAKQSLAAqGYAFVTDTIEEARTLTNRLAPEH 329 Terriglobus s...
WP_014264239   248 IAADLVAQAEHDPEALAVLITSKHELAEEVALETKRQAQ---G--N-EIAQASLAAqGFAFVTKTVEEAQALTNRLAPEH 321 Granulicella ...
WP_012258552   249 VAADLLAQAEHV-EASAILLTPDPVLAEQVQVEVERQLATLPSpnA-QAARDAVTRrGGIVIVPDLATAFMLANDYGPEH 326 Chloroflexus ...
WP_013177847   246 VAADLLAQAEHA-GAQPVFVTTSEALLEAVQLELTRQLVTLPT--R-EVAAASLGR-GYAVLVGTLEEGVEVANRYAPEH 320 Truepera radi...
Q5SKC1         237 LAADLLAQAEHGPDSEPWLLSPDRALLERVEAELSWQLQDLPR--A-EVARQALEK-GGLVLTKDLEEAFALANLYAPEH 312 Thermus therm...
4GIC_B         335 LELSVeSPEVLVESIRNAGAIFXGRYTAEALGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSLIYCSPDGADQLGRTA 414 Methylococcus...
WP_011524483   317 LTV---DE-DLLETVSSAGSVFVGDYSAQSFGDYASGPNHVLPTGGLARVRGGLSVLDYVKIITVQKISRKGLRALAPIA 392 Candidatus Ko...
WP_015897430   322 LTV---DSSADLAWVRNAGSVFVGRWSSQPLGDYVSGPNHTLPTSGLARLRGGLSVMDYLKLVTVQEYSATGVRQLGPSA 398 Acidobacteriu...
jgi:Terro_3621 320 LTV---DSVEDLAWVKNAGSVFIGNYSPQSMGDYISGPNHVLPTGRVGRMRGGLSIYDFLKVITVQNYTAAGLAKLGPHA 396 Terriglobus r...
jgi:AciX9_3063 326 LTV---DNTTDLKWVQNAGSVFVGQYSPQSMGDYVSGPNHVLPTGRAGRIRGGLSVMDFLKIITVQEYTRSGLAHLGPHA 402 Granulicella ...
WP_013569553   330 LTV---DTGADLRWVQNAGSVFIGHHTPQSMGDYISGPNHVLPTGRVGRMRAGLSVLDFVKIITVQQYTRAALHEIGPHT 406 Terriglobus s...
WP_014264239   322 LTV---DAGADLRWVKNAGSVFVGHHTPQSMGDYISGPNHVLPTGRNGRVRGGLSVFDFVKVITVQQYTRDALREVGPHT 398 Granulicella ...
WP_012258552   327 LCLLVaDPWSYVGMVRNAGGIFLGEESFEVLGDYVAGPSHIMPTEGTARYASPVNVDSFRKIISLVGLNRSGLNRIGPAA 406 Chloroflexus ...
WP_013177847   321 LCLLVrDPWAVLPAVEHAGGVFLGASSMEALGDYAAGPSHVMPTGATARFSSALNVRDFQKVIPLVNVSAETLGRIGPAS 400 Truepera radi...
Q5SKC1         313 LSLALsDPLPWLEKVQNAGGVFLGEGSPEALGDYIAGPSHVMPTSGTARFQGGLAVRDFLKVIPVVGLSEGAARELAKKG 392 Thermus therm...
4GIC_B         415 SLLAWGEGL 423 Methylococcus capsulatus str. Bath
WP_011524483   393 ETLAAAEGL 401 Candidatus Koribacter versatilis
WP_015897430   399 VALAEAEGL 407 Acidobacterium capsulatum
jgi:Terro_3621 397 IALAEAEGL 405 Terriglobus roseus DSM 18391
jgi:AciX9_3063 403 IAMAEAEGL 411 Granulicella tundricola MP5ACTX9
WP_013569553   407 ITLAEAEGL 415 Terriglobus saanensis
WP_014264239   399 IALAEAEGL 407 Granulicella mallensis
WP_012258552   407 MRLAEAEGL 415 Chloroflexus aurantiacus
WP_013177847   401 AQMARAEGL 409 Truepera radiovictrix
Q5SKC1         393 ALLARAEGL 401 Thermus thermophilus HB8
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap