4RM8,2I1J


Conserved Protein Domain Family
ERM

?
pfam00769: ERM 
Click on image for an interactive view with Cn3D
Ezrin/radixin/moesin family
This family of proteins contain a band 4.1 domain (pfam00373), at their amino terminus. This family represents the rest of these proteins.
Statistics
?
PSSM-Id: 425860
Aligned: 53 rows
Threshold Bit Score: 149.319
Created: 26-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4RM8_A       338 KEQMMREKEELMLRLQDYEEKTKKAERELSEQIQRALQLEEERKRAQEEAERLEADRMAALRAKEELERQAVDQiksqeq 417 human
EFX76345     338 RETAEREKAALEQQLIHFQEEFRVANEQLRRSEESAELLAEKARVAEEESMLLTQKASDAEQELQRIRLSAMKTeeekll 417 common water flea
XP_001949236 343 REIAEKEKSIMEQRLLQYQEEIRLANEALRRSEETADLLAEKSRVAEEEAMLLGQKATEAEHKITQFRLTALKTeeekvs 422 pea aphid
8_pfamImport   1 REAAEREKTALEQRLLQYQEEIRLANEALRRSEETAELLAEKSRVAEEEAMLLSQKASEAEQELARMRLTAMKTeeekin 80 
XP_008215091 342 REAAEREKAAMEQRLLQYQEEIRLANEALRRSEETADLLAEKSRVAEEEAMLLSQKASEAEQEITRIRLNNMKTeeekvh 421 jewel wasp
OWR55063     337 REAAERERAAMEQRLLQYQEEIRLANDALRRSEETAELLAEKGRVAEEEASLLAQKASDAERENARLRLSAIRTeeekvh 416 Danaus plexippu...
6_pfamImport   1 REAAEREKAAMEQRLMQLQEEMRAANEALHRSEEAAELLAEKNRLAEEEAMLLSHKAQEVEQEINRMRMTARKTeeekmy 80 
EEB14749     334 REAAERDRAEMEQRLLHYQEEIKLANEALRRSEETAELLAEKSKVAEEEAILLSQKASEAEQEITRIRLSAMKTeeekvl 413 human body louse
EFA04811     340 REEAERERANMEQRLLQYQEEIRLANEALKRSEESADLLAEKSRVAEEEAILLSQKAAEAEQEITRLRLSAMRKeeekvt 419 red flour beetle
XP_015784229 361 REEAEREKRELQQRLFQYQEEARVAQEALRRSEETVELLAEKARMAEEDAMMLSQKAAEAEAEIQRFKINAIKTeeeksi 440 two-spotted spi...
4RM8_A       418 lAAELAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKeelh-------------------------------- 465 human
EFX76345     418 sQRQLHEAKQIASRLLENSERCAAEAEQLKGDLLQARYAETQAKkklleflttqatslpayea----------------- 480 common water flea
XP_001949236 423 lERKTREAEQLTARLVDESERRAAEANTLKEELLRARVAEKQAKeklleflsrnayvntsvsslys-------------- 488 pea aphid
8_pfamImport  81 lEKKTREAEQLTARLVDESERRAFEANRLKDELLKARLAEKEAKeklleflsrnty------------------------ 136
XP_008215091 422 lEQKTRDAVRLTEMLVQESEKRALEEKKLKDELLRARIAEKEAKeklleflsrnhytsaiavl----------------- 484 jewel wasp
OWR55063     417 lERKTREAEFLTARLVEESEKRAAEAERLKAELVAARVAEKQAKekllnflsrtsng----------------------- 473 Danaus plexippu...
6_pfamImport  81 lERKTQEAELLTARMMEESRKRALEADKLKNELIHARVAEKEAKekllnf------------------------------ 130
EEB14749     414 lERKTREAEFLTARLVEESERRAAEAERLKDHLLRARLAEKQAKeklleflsinafhnltnsvrkflfkdiyi------- 486 human body louse
EFA04811     420 lERKTREAELLTARLVEDSERRAAEANRLKEELLRARAAEKQAKeklldflsrgsysssatsvstl-------------- 485 red flour beetle
XP_015784229 441 mERKATEAELLATTMVEESERRAKEAEQLREELLKAKLSEREAKeklfdilrmpsqspqhdsttiyingsqindtecpks 520 two-spotted spi...
4RM8_A       466 -----------------------------------------------------------------lvmtAPPPPpppvye 480 human
EFX76345     481 --------------------------------------------------rlpiplanqltgltnltglSSSGY------ 504 common water flea
XP_001949236 489 ------------------------------------------------vssssaldlpadlhalrlnanSPQLS------ 514 pea aphid
8_pfamImport 137 ---------------------------------------------------------istsmnslynsaAPTLS------ 153
XP_008215091 485 ---------------------------------------------------psdlqadlqtlqldseplSS--------- 504 jewel wasp
OWR55063     474 --------------------------------------------------------slpppsassspfpSSCSL------ 491 Danaus plexippu...
6_pfamImport 131 ----------------------------------------------------------------lsrtsTESIL------ 140
EEB14749     487 -----------------------------------------yrtvssmftnstvvcvdghddidplrrnvPQ-------- 517 human body louse
EFA04811     486 ------------------------------------------------ysaslsplgpdlslldgdvgtSPELN------ 511 red flour beetle
XP_015784229 521 pttngalinseplyitnnldtfdhhsqschnnlkeltindvavnetypiivnptnlspsctnssyqlytSSNTT------ 594 two-spotted spi...
4RM8_A       481 PVSYHVQESLQDEGAEpt--gYSAELSsEGI--RD---DRNEEKRITEAEKNERVQRQLLTLSSELSQARDENKRTHNDI 553 human
EFX76345     505 LSAIAASELVN-SSANy-------DLMtHGD--MEqlsLEIEKERVEYLEKSKQLQEQLRELRTEIEVLKVGEKQTLYDQ 574 common water flea
XP_001949236 515 LTHSNPPALVDHNLPAy-------DFIaGND--MEeltLEIEKERIQYLEKSKHLQDQLRDLKTEIEVLKVDEKQCELDM 585 pea aphid
8_pfamImport 154 AT----------DLTSy-------ELTpDTD--MMqlsLEIEKERVDYLEKSKHLQNQLRDLKSEIEVLKIGEKQCELDL 214
XP_008215091 505 ------------EVNCy-------DLIvDGD--ADqlsLEIEKERIDYLEKSKHLQEQLRDLRTEIAVLKVGEKQCELDQ 563 jewel wasp
OWR55063     492 PAELSEAPLADPELTAy-------TLVsDDDphIHrlsVEIEKERVEYLAKSKHLQQQLDELRCEFSVLRV--EQGGLDH 562 Danaus plexippu...
6_pfamImport 141 ITPSSSPESPMHEMHSy-------DLLaDGD--MEqlsLEIEKERVEYLAKSKQVQNQLKELRSEIEQLKIGENQCPLDD 211
EEB14749     518 ------------DLSQy-------DALcHHD--VQqlsLEIEKERVEYLEKSKQVQEQLRDLRSEIEELKVGEKTTELDN 576 human body louse
EFA04811     512 L-----------TLNGy-------DLT-NAD--TDqlsLEIEKERGLCLEKQKHLQHQLRELRTEIAVLKVAEKQTEFDQ 570 red flour beetle
XP_015784229 595 TTATSVSARRHDSLNNivttpTSCELInDTD--VEklvLEIEKERMEYLKKSRHLQEQLRDLKSEIEVLKVEDRLTSMDR 672 two-spotted spi...
4RM8_A       554 IHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAL 587 human
EFX76345     575 LHEEQLRSGDDKYSTLKKSKSGSTGARVAFFEEL 608 common water flea
XP_001949236 586 LHDEQVRLGENKYSTLKKVKCGSTKARVAYFEEL 619 pea aphid
8_pfamImport 215 LHDEQVRLGETKYSTLRKVRSGSTKARVAFFEDL 248
XP_008215091 564 LHEEQVRLGENKYSTLKKVKSGSTKARVAFFEEL 597 jewel wasp
OWR55063     563 LHDVQARAGEDKYSTLRRLKQGSTRTRVAFYEDL 596 Danaus plexippus plexippus
6_pfamImport 212 INAEQLRLGETKYSTLKKVKSGSTKARVAFFEEL 245
EEB14749     577 LHDEQVRLGENKYSTLRKVKSGSTKARVAFFEEL 610 human body louse
EFA04811     571 LHSEQVKLGENKYSTLKKSKSGSTKSRVAFFEEL 604 red flour beetle
XP_015784229 673 IHEENLNRGDNKYSTLRRTKSGTTKARVAFFEDL 706 two-spotted spider mite
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap