3DO5,3ING,5XDF


Conserved Protein Domain Family
Homoserine_dh

?
pfam00742: Homoserine_dh 
Click on image for an interactive view with Cn3D
Homoserine dehydrogenase
Statistics
?
PSSM-Id: 459921
Aligned: 799 rows
Threshold Bit Score: 71.6345
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3DO5_A        148 PVVKLA-KRYLALCEIESVKGIFNGTCNYILSRXE--EeRLPYEHILKEAQELGYAEADPSYDVEGIDAALKLVIIANTI 224 Archaeoglobus ...
WP_009945885  142 mpagdLaRSVLRGFDVRAVRGCLNGTATFVLDRLA--Er-VPQAEAVARAQELGIAEADVSADLSGGDAATKMRLLAALL 218 Saccharopolysp...
BGI:SBI_04777 191 lpagdlaragVRGLGCRTVRACPNGTATFVLDRLA--Ag-DSLADAVAEARRRGIAEADPSADLSGSDAATKARLLAALL 267
Q9RJR6        157 lpagdLsRTSLRGLDCRTIRACPNGTATFVLDRLA--Eg-DTLGDAIRAAQLRGIAEADPSADLSGDDAATKVRLLAALA 233 Streptomyces c...
AGY54236      614 PVISTIrGRRECGDNIQRVEAILSGTLNYLFSKYDg---SvrFTDLVEQARRAGYTEPDPRIDLAGTDTMRKALILARES 690
CCY37548      201 PVLESVaSCVCSGDRIHRVEAVLSGTLNYIFSTYDggK-SvtFAEVVRQAVEKGYAEPDPRIDLSGRDVLRKLLILGREA 279
CDA96633      616 PILESIaRSVNSGDDIARVDAVLSGTLNYIFSTYKggEdGktFADVVRQAQEAGYSEPDPRLDLSGRDVLRKLLILSREA 695
XP_002899591  691 PVIDTLgNILRTGDRVLGIETSLSGSMNFVANEVMk---GkkLSEAVGLVLRKGYCERDPREDFTGTDMVAKVVVLARAL 767
6_pfamImport    1 PIIDTLgNILRTGDRILGIDTSLSGSMNFVANEVMk---GkkLSEAVGEVLCRGYCERDPREDFTGTDMVAKVVVLARAL 77 
1_pfamImport    1 PIIDTLgNILRTGDRILGIDTSLSGSMNFVANEVMk---GkkLSEAVGEVLCRGYCERDPREDFT--------------- 62 
3DO5_A        225 -GVKASYEDVEVTGIT---------------------QITPEA-------FQVAAEKGYTIRLIAEvs---rEk------ 266 Archaeoglobus ...
WP_009945885  219 wGWDPARTEVSAEPV-----------------------------------AERGVEPGHRLRHVASaeadrpGv------ 257 Saccharopolysp...
BGI:SBI_04777 268 wGWDASAVRTETEAVD---------------------DGTARA-------AREAAASGHRLRAVASaradepLl------ 313
Q9RJR6        234 wGWDPAEVRVRAEPVD---------------------GTTARR-------ALAAAARSRRLRAVAGaavaepGv------ 279 Streptomyces c...
AGY54236      691 -GFRLEPDEIEIRPFLnealfsa-------didifyaKLRDYEeki-aarFRESEAKGERLRFIAK------Idk----- 750
CCY37548      280 -GAALEEGDVEAEPLLpqeyfrg-------svedfykALEDNEksf-aeqFLQAASRGLRLRFVAS------Lervplsg 344
CDA96633      696 -GAAIDEADVEIDPILgpeffsg-------kvpafyeMLAANEssf-ataYREAADKGLRQRFVAS------Lvavpee- 759
XP_002899591  768 -GVHINPNAVQLEPLIpqsvldtitwsndmevddivsGLQAYDevfhekyYAPAVAENKRLHYVAS------Idlskf-- 838
6_pfamImport   78 -GVHIHASEVRVEPFIphsvlgtiawshdvdvgdiviGLEAYDeefqkkfYMPAVSEGKRLHYVAS------Idlaes-- 148
1_pfamImport   63 ---------VRVEPFIphsvlgtiawshdvdvgdiviGLEAYDeefqkkfYMPAVSEGKRLHYVAS------Idlaks-- 125
3DO5_A        267 ------------LKVSPRLVPFHHPLA-IKGTXNAAXFKTDTAGS--IFVAGRGAGKEETASAILSDL 319 Archaeoglobus fulgidus
WP_009945885  258 ------------VEVRLSAEPVTSPLGaLTGPEKAVTYDCGEAGP--VTVSGGRSSPRGAALAMVKDT 311 Saccharopolyspora erythraea
BGI:SBI_04777 314 ------------VRVRLERTAPGDPLHaLTGPEKAVVYGCPDAGD--ITVSGGRSSPLGAALAMVKDT 367
Q9RJR6        280 ------------VRVRLEETEAGDPLHaLTGPEKAAVFGCPDAGD--VTVSGGRSSPVGAALALVKDT 333 Streptomyces coelicolor
AGY54236      751 ----------egCSIGLESIGSSHPFYnICGRDNSVMIYSDEYTSp-LIVTGAGAGASLTASGIFSDL 807
CCY37548      345 dessgaspcrwkARIALEALSPEHPLYsLEGTDNTVILTTDFYPSp-LVIRGAGAGAYQTASGVLNDI 411
CDA96633      760 ------ggvhykASMGLQCVGPENPLFnLCGTDNAALIKTAFYPSp-LVVQGAGAGAYQTASGVLNDI 820
XP_002899591  839 --------psiqAKIQPLLVSEDHPAFyTKDNEIAFGFSSVQY-PnsLVLKGSGTGAAASATGVLRDV 897
6_pfamImport  149 --------ptiqATIRPLLVGEAHPVFyTKDNEIAFGVSSMQY-PnpLVLKGSGTGASASATGVLRDV 207
1_pfamImport  126 --------ptiqATIRPLLVGEAHPVFyTKDNEIAFGVSSMQY-PnpLVLKGSGAGASASATGVLRDV 184
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap