5WJT


Conserved Protein Domain Family
Flagellin_N

?
pfam00669: Flagellin_N 
Click on image for an interactive view with Cn3D
Bacterial flagellin N-terminal helical region
Flagellins polymerize to form bacterial flagella. This family includes flagellins and hook associated protein 3. Structurally this family forms an extended helix that interacts with pfam00700.
Statistics
?
PSSM-Id: 425809
Aligned: 22 rows
Threshold Bit Score: 93.5616
Created: 26-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5WJT_H          3 INHNIAALNTLNRLSSNNSASQKNMEKLSSGLRINRAGDDAAGLAISEKMRGQIRGLEMASKNSQDGISLIQTAEG--AL 80  Bacillus subtilis
P29744          3 FSTQMMYQQNMRGITNSQAEWMKYGEQMSTGKRVVNPSDDPIAASQAVVLSQAQAQNSQYTLARTFATQKVSLEES--VL 80  Escherichia co...
jgi:M446_6508   6 ISTQSLWNAPRSATARLQAESAKATQEVASGRYADVGLELGSRVSVSLALRGQQDQLAALKQDNGLTALRLDQTQA--TL 83  Methylobacteri...
1_pfamImport    1 ISSLAMQNSMRSTILKAQLEMTNLNTELTTGKHADLGLTLGANTARSLDLNRDIDRISSLVSVNSIATQRLKSSQT--AL 78 
Q11LP4          6 VSTSAISQTLRYQMMRMQADLVKNQKELDSGRLADPGATLGARAGFSFSMDREISRLENVIDANSLAANRLTATQN--NL 83  Chelativorans ...
Q2YJG1          6 ISTYGATSALRALVAKNKAEMVKAQQEATTGTVFDVGLSLGSRTGQTVSLRKEYDRLSVLTDMNKLVQQRMTATQT--AA 83  Brucella abort...
Q89F45          7 ISTLMLSSSLRTSITNNQAALSKASKEATTGRFADVGLELGATTGGDLTLRADWSFADQLVDTNELVSGRLDVTQT--RI 84  Bradyrhizobium...
Q21AA9          6 ISTNSISTTLRISAMKSQAALSRATKEATTGRNADVGLSLGALAGRDVVLRAELLNVDKLVDTNGLVGGRLDTAQQ--RV 83  Rhodopseudomon...
P02969          5 VNTNQPALIALQNLNRTNDDMQAVQTRINTGEAISTAKDTAAVWS----HRPGAGDMSGLAREDEPGSGDIDRGRGprAG 80  Caulobacter vi...
Q03841          4 ILTNNSAMAALSTLRSISSSMEDTQSRISSGLRVGSASDNAAYWSIATTMRSDNQALSAVQDALGLGAAKVDTAYS--GM 81  Sinorhizobium ...
5WJT_H         81 TETHAILQR-VRELVVQAGNTGTQDKatDLQSIQDEISALTDEIDGISNRTEFNGKKLLDGTYK 143 Bacillus subtilis
P29744         81 SQVTTAIQN-AQEKIVYASNGTLSDD--DRASLATDIQGLRDQLLNLANTTDGNGRYIFAGYKT 141 Escherichia coli K-12
jgi:M446_6508  84 KQLQAAADDtLKQLLGASIDKKVSTI---STLAATQLAALTSALN-----GAANGQYLFAGLNT 139 Methylobacterium sp. 4-46
1_pfamImport   79 DGMAKAAQE-IQKVLVPNTSSEAPTLttVSQTISNAFNNFTSFAN-----TAVNGEFLFSGINT 136
Q11LP4         84 TQLTDISQElLATLSAALSGVNDTSI--VKSGATRALESMTSVLN-----SNFNGEYLFAGINT 140 Chelativorans sp. BNC1
Q2YJG1         84 GKIIENTQNfLGDLAGANNSGETAKT--VAKSARSMLDSVTGLLN-----TSFNGEYIFAGVNT 140 Brucella abortus 2308
Q89F45         85 TQLGTTATSfLKDLIAARSTDNGGRI--VLPPASANLQDLIGALN-----VSYNGSYLFSGINT 141 Bradyrhizobium japonicum
Q21AA9         84 DELIDTAKSfQKDLLAARNSAGGGTI--IAQSASANLQGLISTLN-----VTMDGQYLFGGINT 140 Rhodopseudomonas palustris BisB18
P02969         81 ESVSDLLKL-MREKVVAAKDTSLTTT--SRQALNADFQGLIKNLNQVLRSATFDGANLLDGSQA 141 Caulobacter vibrioides CB15
Q03841         82 ESAIEVVKE-IKAKLVAATEDGV-----DKAKIQEEITQLKDQLTSIAEAASFSGENWLQAdls 139 Sinorhizobium meliloti 1021
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap