6VOY,5TC2


Conserved Protein Domain Family
IN_DBD_C

?
pfam00552: IN_DBD_C 
Click on image for an interactive view with Cn3D
Integrase DNA binding domain
Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain. The central domain is the catalytic domain pfam00665. This domain is the carboxyl terminal domain that is a non-specific DNA binding domain.
Statistics
?
PSSM-Id: 425747
Aligned: 8 rows
Threshold Bit Score: 62.0301
Created: 16-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6VOY_A    325 FKLPGLNSRQWKGPQEALQEAAGAALI--PVSASSAQWIPWRLLKRA 369  Saccharolobus solfataricus P2
EGW11815   68 VKWKDILSGLWCGPDPVLTWARGSVCVf-PQDQQDPVWVPERLIRKI 113  Chinese hamster
P11283   1655 VMWKDLLAGSWKGPDVLITAGRGYACVf-PQDAETPIWVPDRFIRPF 1700 Mouse mammary tumor virus (STRAIN C3H)
P31623   1667 VRWKDPLTNLWYGPDPVLIWGRGHVCVf-PQDAEAPRWIPERLVRAA 1712 Jaagsiekte sheep retrovirus
EGV97962   18 VKWKDHCTGLQKGPDPVLIWGRGHVCLffSQEENEVQWLPECLVRCV 64   Chinese hamster
Q0R5R2   1375 YKIPGLTNSRWSGPVQSLKEAAGAALI--PVGGSYL-WIPWRLLKRG 1418 HTLV-3 strain 2026ND
5TC2_B      8 VYYRDSRNSLWKGPAKLLWKGEGAVVI---QDNSDIKVVPRRKAKII 51   Human immunodeficiency virus 1
P18096   1395 VYYREGRDQLWKGPGELLWKGEGAVIV---KVGTDIKVVPRRKAKII 1438 Human immunodeficiency virus type 2 (ISOLATE BEN)
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap