1E9Y,4FUR


Conserved Protein Domain Family
Urease_gamma

?
pfam00547: Urease_gamma 
Click on image for an interactive view with Cn3D
Urease, gamma subunit
Urease is a nickel-binding enzyme that catalyzes the hydrolysis of urea to carbon dioxide and ammonia.
Statistics
?
PSSM-Id: 459850
Aligned: 148 rows
Threshold Bit Score: 109.816
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1E9Y_A         1 MKLTPKELDKLMLHYAGELAKKRKEKGIKLNYVEAVALISAHIMEEARAGkKTAAELMQEGRTLLKPDDVMDGVASMIHE 80  Helicobacter py...
CAL77819       2 MNLSPTELDRLVIFNAAQMARRNRSLGIKLSHPEAVAYITDEVMTAARRN-LPYAEIRDMAGRLLTTDDVEPGVAQMIPM 80 
Q883F3         1 MLLTPTELERLTLYTAAELSRKRRGKGLRLNFPEASALIADEILEGAREG-RSVAELIGFGSTILNTDDVMPGVADLLPV 79  Pseudomonas syr...
AHC27297       1 MHLTPKDEDRLLVFLAAELARKHRAAGLALTYAEARALIADEVIEAARSG-AGVAEAAAIGADLLTDDDVMPGVRTLLGS 79 
WP_024102405   1 MHLTPKEEDRLLLFLAAELARRHKDKGLKLSYPEARALIADEVVEAARAG-ATVAEAAHVGAHLLTEDDLLPGVATLVGT 79  Rhodococcus pyr...
WP_023416840   1 MRLTPTERDRLLIFNAAQLARARQARGLRLNVPEATALISDTVGEAARDG-ARLAEAVAVGRAVLGPDDVLPGVADVLTE 79  unclassified St...
WP_014145069   1 MRLTPTERDRLLLFGAAQLARTRLARGLKLNVPEATALIADTVCEAARDG-ARLADAIEAGRRALRPDDVLPGVADVVGD 79  Streptomyces ca...
WP_013000477   1 MRLTPTERDRLLLFGAAELARARRARGLRLNVPETTALVADAVCEAARDG-LRLAEAIDRARSLLGPDDVLPGVADVVRE 79  Streptomyces
WP_013132846   1 MHLTPREQERLTIFTLAELARRRRARGRRLNAPEAIALICDEILELAWDG-ASLEEVVAAARSVLTADDVMEGVPALVPH 79  Thermobispora b...
WP_058125316   1 MNLTPTELERLTVFTAAEMARRNLREGVLLSHPEAVALLTDEVMLAARKN-LAYDEVVDMAANLLQAKDCEPGVPDLVRM 79  Mycolicibacteri...
1E9Y_A        81 VGIEAMFPDGTKLVTVHTPI 100 Helicobacter pylori
CAL77819      81 LYVELMFAEGTKVMALFEPI 100
Q883F3        80 LQVEGTFPDGTKLVTVHQPI 99  Pseudomonas syringae pv. tomato str. DC3000
AHC27297      80 VQVEAFFDDGQKLVTVHDAI 99 
WP_024102405  80 VQVEGFFDDGQKLVTIHDPI 99  Rhodococcus pyridinivorans
WP_023416840  80 IQVEAVFEDGSRLAVLADPI 99  unclassified Streptomyces
WP_014145069  80 VMVEAVFADGSRLAVVTDPI 99  Streptomyces cattleya
WP_013000477  80 VHVEAVFEDGSRLAVVPDPV 99  Streptomyces
WP_013132846  80 VQVEALFPNGTALVAVDQPI 99  Thermobispora bispora
WP_058125316  80 VMIDAPFPDGTKLVALIDPI 99  Mycolicibacterium smegmatis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap