Conserved Protein Domain Family
SSF

?
pfam00474: SSF 
Sodium:solute symporter family.
Statistics
?
PSSM-Id: 109527
View PSSM: pfam00474
Aligned: 10 rows
Threshold Bit Score: 397.481
Threshold Setting Gi: 239938811
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P31637  39 YFLAGRSMTWVAIGASLFVSNIGSEHFIGLAGSGAASGFAVGAWEFNALLLLQLLGWVFIPIYI-----RSGVYTMPEYL 113 dog
P31636  58 FFLAGRDVTWWPMGASLFASNIGSGHFVGLAGTGAASGIAIAAFEWNALLLLLVLGWFFVPIYI-----KAGVMTMPEYL 132 pig
P13866  58 FFLAGRSMVWWPIGASLFASNIGSGHFVGLAGTGAASGIAIGGFEWNALVLVVVLGWLFVPIYI-----KAGVVTMPEYL 132 human
P16256  36 YFLGSRSMGGIVLAMTLTATYISASSFIGGPGAAYKYGLGWVLLAMIQLPAVWLSLGILGKKFAil-arRYNAVTLNDML 114 Escherichia coli K-12
P44963  36 YYVGNRSMTGFVLAMTTASTYASASSFVGGPGAAYKYGLGWVLLAMIQVPVVWLALGALGKKFAll-srETNALTINDLF 114 Haemophilus influenza...
P45174  35 YILGGRRLGSFVTAMSAGASDMSGWLLMGLPGAVYLSGLVEGWIAIGLTIGAYFNWLLVAGRLRvytelNNNALTLPEYF 114 Haemophilus influenza...
P07117  35 YILGGRSLGPFVTALSAGASDMSGWLLMGLPGAVFLSGISESWIAIGLTLGAWINWKLVAGRLRvhteyNNNALTLPDYF 114 Escherichia coli K-12
P39599  33 FYTAGGGLTGVQNGLAIAGDYMSAASFLGIAGMIALYGFDGFFYSIGFLVAYLVVLYIVAEPLR-----NLGKYTMADMI 107 Bacillus subtilis sub...
P32705  63 YYTAGGNITGFQNGLAIAGDYMSAASFLGISALVFTSGYDGLIYSLGFLVGWPIILFLIAERLR-----NLGRYTFADVA 137 Escherichia coli K-12
P31639  55 YFLAGRSMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNALFVVLLLGWLFAPVYL-----TAGVITMPQYL 129 human
P31637 114 SKRFGGHR-IQVYFAALSLILYIFTKLSVDLYSGALFIQESLGWNLYVSVILLIGMTALLTVTGGLVAVIYTDTLQALLM 192 dog
P31636 133 RKRFGGKR-LQIYLSILSLFICVALRISSDIFSGAIFIKLALGLDLYLAIFSLLAITAIYTITGGLASVIYTDTLQTIIM 211 pig
P13866 133 RKRFGGQR-IQVYLSLLSLLLYIFTKISADIFSGAIFINLALGLNLYLAIFLLLAITALYTITGGLAAVIYTDTLQTVIM 211 human
P16256 115 FARYQSRL--LVWLASLSLLVAFVGAMTVQFIGGARLLETAAGIPYETGLLIFGISIALYTAFGGFRASVLNDTMQGLVM 192 Escherichia coli K-12
P44963 115 FYRYKNKY--LVWLSSLALLLAFFAAMTVQFIGGARLLETTIGISYTQALLLFALTVGIYTFIGGFRAVVLTDTIQGTVM 192 Haemophilus influenza...
P45174 115 HNRFGSSHkLLKLVSATIILVFLTIYCASGVVAGAKLFQNIFSVEYSTALWYGAAATIAYTFIGGFLAVSWTDTIQATLM 194 Haemophilus influenza...
P07117 115 TGRFEDKSrILRIISALVILLFFTIYCASGIVAGARLFESTFGMSYETALWAGAAATILYTFIGGFLAVSWTDTVQASLM 194 Escherichia coli K-12
P39599 108 AARFKEKK--IRGVAALNTIAISTFYMIAQLVGAGALIKLLLGLDYTAAVLIVGVLMTIYVVFGGMIATSWVQIIKAVLL 185 Bacillus subtilis sub...
P32705 138 SYRLKQGP--IRILSACGSLVVVALYLIAQMVGAGKLIELLFGLNYHIAVVLVGVLMMMYVLFGGMLATTWVQIIKAVLL 215 Escherichia coli K-12
P31639 130 RKRFGGRR-IRLYLSVLSLFLYIFTKISVDMFSGAVFIQQALGWNIYASVIALLGITMIYTVTGGLAALMYTDTVQTFVI 208 human
P31637 193 IVGALTLMIISMMEIG--GFEEVKRRYMLASPNVtsILLtynlsntnscNVhpkKDALKMLRNPTDEDVPWPGFVLGQTP 270 dog
P31636 212 LIGSFILMGFAFVEVG--GYESFTEKYMNAIPTIveGDNltis---pkcYTp-qGDSFHIFRDAVTGDIPWPGMIFGMTV 285 pig
P13866 212 LVGSLILTGFAFHEVG--GYDAFMEKYMKAIPTIvsDGNttfq---ekcYTp-rADSFHIFRDPLTGDLPWPGFIFGMSI 285 human
P16256 193 LIGTVVLLIGVVHAAG--GLSNAVQTLQTIDP-----QL----------VT---PQGADDILSPAFMTSFWVLVCFGVIG 252 Escherichia coli K-12
P44963 193 IFGTIILLIGTIYALG--GVESAVNKLTEIDP-----DL----------VT---PYGPNGMLDFQFMASFWILVCFGVVG 252 Haemophilus influenza...
P45174 195 IFALILTPVFVLLSFAdtAQFSAVLEQAEAAVNKdfTDL----------FT---STT------PLGLLSL-AAWGLGYFG 254 Haemophilus influenza...
P07117 195 IFALILTPVIVIISVGgfGDSLEVIKQKSIEN----VDM----------LK---GLN------FVAIISL-MGWGLGYFG 250 Escherichia coli K-12
P39599 186 MAGTLVISIIVFSKFGf-SLNTMFEQMKTATPLG--ADF----------LN---PGNK--YKVPLETLSLNLALVLGTAG 247 Bacillus subtilis sub...
P32705 216 LFGASFMAFMVMKHVGf-SFNNLFSEAMAVHPKG--VDI----------MK---PGGL--VKDPISALSLGLGLMFGTAG 277 Escherichia coli K-12
P31639 209 LGGACILMGYAFHEVG--GYSGLFDKYLGAATSLtvSEDpavgnissfcYRp-rPDSYHLLRHPVTGDLPWPALLLGLTI 285 human
P31637 271 AsvwywcadQVIVQRVLAAKniahaKGSTLMAGFLKLLPMFIIVVPGMISRILFADDIACINPehcmQVCGSRAGCSNIA 350 dog
P31636 286 VaawywctdQVIVQRCLSGKdmshvKAACIMCGYLKLLPMFLMVMPGMISRILYTEKVACVVPsecvKHCGTEVGCSNYA 365 pig
P13866 286 LtlwywctdQVIVQRCLSAKnmshvKGGCILCGYLKLMPMFIMVMPGMISRILYTEKIACVVPseceKYCGTKVGCTNIA 365 human
P16256 253 L--------PHTAVRCISYK-----DSKAVHRGIIIGTIVVAILMFG--------MHLAGALG----RAVIPDLTVPDLV 307 Escherichia coli K-12
P44963 253 L--------PHTAVRCMAFK-----DSKALHRGMLIGTIVLSIIMLG--------MHLAGALG----RAVIPNLTVSDQV 307 Haemophilus influenza...
P45174 255 Q--------PHILARFMAAD-----SVKSLIKARRISMGWMVLCLAGAIGIGLFAIPYFFANP----AIAGTVNREPEQV 317 Haemophilus influenza...
P07117 251 Q--------PHILARFMAAD-----SHHSIVHARRISMTWMILCLAGAVAVGFFGIAYFNDHP----ALAGAVNQNAERV 313 Escherichia coli K-12
P39599 248 L--------PHILIRFYTVK-----DAKTARTSVVSATWIIGVFYIMTVFLGFGAAAFVGF------DAITAADQAGNMA 308 Bacillus subtilis sub...
P32705 278 L--------PHILMRFFTVS-----DAREARKSVFYATGFMGYFYILTFIIGFGAIMLVGANPey-kDAAGHLIGGNNMA 343 Escherichia coli K-12
P31639 286 VsgwywcsdQVIVQRCLAGKslthiKAGCILCGYLKLTPMFLMVMPGMISRILYPDEVACVVPevcrRVCGTEVGCSNIA 365 human
P31637 351 YPRLVMKLVPVGLRGLMMAVMIAALMSDLDSIFNSASTIFTLDVYKLIRRSASSRELMIVGRIFVAFMVVISIAWVPIIV 430 dog
P31636 366 YPLLVMELMPSGLRGLMLSVMLASLMSSLTSIFNSASTLFTMDLYTKIRKQASEKELLIAGRLFIILLIVISIVWVPLVQ 445 pig
P13866 366 YPTLVVELMPNGLRGLMLSVMLASLMSSLTSIFNSASTLFTMDIYAKVRKRASEKELMIAGRLFILVLIGISIAWVPIVQ 445 human
P16256 308 IPTLMVKVLPPFAAGIFLAAPMAAIMSTINAQLLQSSATIIKDLYLNIRPDQMQNETRLKRMSAVITLVLGALLLLAAWK 387 Escherichia coli K-12
P44963 308 IPTLMIKVLPPIVAGIFLAAPMSAIMSTIDAQLIQSSSIFVKDLYLSAKPEAAKNEKKVSYFSSIITLILTALLIFAALN 387 Haemophilus influenza...
P45174 318 FIELAKLLFNPWIAGILLSAILAAVMSTLSAQLLISSSSITEDFYKGFIRPN-ASEKELVWLGRIMVLVIAALAIWIAQD 396 Haemophilus influenza...
P07117 314 FIELAQILFNPWIAGILLSAILAAVMSTLSCQLLVCSSAITEDLYKAFLRKH-ASQKELVWVGRVMVLVVALVAIALAAN 392 Escherichia coli K-12
P39599 309 APLLAKALGGDFLFAFVSAIAFATILAVVTGLVLSAASAFAHDIYSQIIRKGEATEKEQMKAARWASVAVSVLSILLAIF 388 Bacillus subtilis sub...
P32705 344 AVHLANAVGGNLFLGFISAVAFATILAVVAGLTLAGASAVSHDLYANVFKKG-ATEREELRVSKITVLILGVIAIILGVL 422 Escherichia coli K-12
P31639 366 YPRLVVKLMPNGLRGLMLAVMLAALMSSLASIFNSSSTLFTMDIYTRLRPRAGDRELLLVGRLWVVFIVVVSVAWLPVVQ 445 human
P31637 431 EMQGGqMYLYIQEVADYLTPPVAALFLLAIFWKRCNEQGAFYGGMAG 477 dog
P31636 446 VAQNGqLFHYIESISSYLGPPIAAVFLLAIFCKRVNEQGAFWGLIIG 492 pig
P13866 446 SAQSGqLFDYIQSITSYLGPPIAAVFLLAIFWKRVNEPGAFWGLILG 492 human
P16256 388 PPEM--IIWLNLLAFGGLEAVFLWPLVLGLYWERANAKGALSAMIVG 432 Escherichia coli K-12
P44963 388 PPDM--IIWLNLFAFGGLEAAFLWVIVLGIYWDKANAYGALSSMIIG 432 Haemophilus influenzae Rd KW20
P45174 397 ENSK--VLKLVEFAWAGFGSAFGPVVLFSLFWKRMTSSGAMAGMLVG 441 Haemophilus influenzae Rd KW20
P07117 393 PENR--VLGLVSYAWAGFGAAFGPVVLFSVMWSRMTRNGALAGMIIG 437 Escherichia coli K-12
P39599 389 AQSLN-VAFLVALAFAVAASANLPLIVFTVFWKRFNASGALWGSLTG 434 Bacillus subtilis subsp. subtilis str. 168
P32705 423 FENQN-IAFMVGLAFAIAASCNFPIILLSMYWSKLTTRGAMMGGWLG 468 Escherichia coli K-12
P31639 446 AAQGGqLFDYIQAVSSYLAPPVSAVFVLALFVPRVNEQGAFWGLIGG 492 human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap