2GHJ


Conserved Protein Domain Family
Ribosomal_L20

?
pfam00453: Ribosomal_L20 
Click on image for an interactive view with Cn3D
Ribosomal protein L20
Statistics
?
PSSM-Id: 425691
Aligned: 341 rows
Threshold Bit Score: 94.3554
Created: 26-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2GHJ_B         2 RVK-GPSSRRKKKKILKLAKGYRGQRSRSYRRAKEAVXRALYYQYRDRKLRKREFRRLWIARINAAVRAYGLNYSTFING 80  Aquifex aeolicus
EEC16122      11 RVKsGGNRFWKRKRIFQLAANFYGRRRNCFTIAIRSVEKALTHVAEGRQVKKTEMGRLWKTRTEAAAQELGFNYANLRHN 90  black-legged tick
NP_001155704  10 vrsrGPDEFWRKRKIFKIAAHFSGRRRNCYSIAIKAVHRALQFATIGRTVRKTDMIDLWNTRIKAGCEEHGVEINNFKDS 89  pea aphid
EDV97821      10 vrarGPDEFWRKRRIFKLAAHYRSRTRNVYSFAIRSVHRALAYATTGRKLKKLDMAQLWTTRVEAGCQQYGVALDTFKEG 89  Drosophila grim...
XP_975195     10 vrsrGPDEFWRKRKVFKLAAAYIGRSRNCYSIAIRSVHRALVYATKGRKLKKEDFSNLWDTRITAGCEQHDINYHVFKES 89  red flour beetle
Q2F656        10 arcrGPDEFWRKRRVFRLAAHYIGRRRNCYSIAVRNVHRALVYATKARKLKKEDMKSLWDVRITAACEQHNITLFSLREG 89  domestic silkworm
XP_012064169  10 trarGPDEFWRKRKIFKLAAHFFGRRRNCYSIAIKGVHRALIYSTTGRKLKKEDMKELREQRLGAATSEHGINFTILREG 89  Atta cephalotes
EFN66402      10 vrarGPDEFWRKRKIFKLAAHYIGRRKNCYSITIRTVQRALVYATQGRHEKKEDIRELREQRLEAATTQHGINFRTLKEG 89  Florida carpent...
EFN79772      10 vrsrGPDEFWRKRKIFRLAAHYIGRRRNCYSITIKNVHRALEYSTAGRQQKREDMLELQEQRIDAATHEHGISFKVFTQS 89  Jerdon's jumpin...
XP_393443     10 vrcrGPDEFWRKRQIFKLAAHYIGRRRNCYSLTIKSVHRALQFSTKGRKLKKQDMRELWETRIDAATNEHGIGLKVLLEG 89  honey bee
2GHJ_B        81 LKKAGIELDRKILADXAVRDPQAF 104 Aquifex aeolicus
EEC16122      91 LTKCSIALDRRILSDLAYSEPRTF 114 black-legged tick
NP_001155704  90 LSRCDIQLNKKVLADLAIWEPNSF 113 pea aphid
EDV97821      90 LARSDIQLNKKMLSDLAIWEPRSF 113 Drosophila grimshawi
XP_975195     90 LARNNILLNRNTLATLACWEPFTF 113 red flour beetle
Q2F656        90 LDRANIMLDRKSLSDLASWEPKTF 113 domestic silkworm
XP_012064169  90 LTRCNILLNRKSLTDLAIWEPRSF 113 Atta cephalotes
EFN66402      90 LARCNILLNRKVLADLSIWEPRSF 113 Florida carpenter ant
EFN79772      90 LARCNILLNRKVLADLAIWEPRSF 113 Jerdon's jumping ant
XP_393443     90 LSRCNILLNRKSLAILAIWEPRTF 113 honey bee
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap