6N2Y,6OQR


Conserved Protein Domain Family
ATP-synt_B

?
pfam00430: ATP-synt_B 
Click on image for an interactive view with Cn3D
ATP synthase B/B' CF(0)
Part of the CF(0) (base unit) of the ATP synthase. The base unit is thought to translocate protons through membrane (inner membrane in mitochondria, thylakoid membrane in plants, cytoplasmic membrane in bacteria). The B subunits are thought to interact with the stalk of the CF(1) subunits. This domain should not be confused with the ab CF(1) proteins (in the head of the ATP synthase) which are found in pfam00006
Statistics
?
PSSM-Id: 425677
Aligned: 15 rows
Threshold Bit Score: 88.5236
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6N2Y_b1  11 IIYQLLMFIILLALLRKFAWQPLMNIMKQREEHIANEIDQAEKRRQEAEKLLEEQRELMKQSRQEAQALIENARKLAEEQ 90 
Q31RF3   22 FETNLINLAIIIGLLVYAGRGFLGNLLSNRRAAIEAEIREVEEKLASSAQALSQAQTQLKEAEAEAARLLVEAKARAAAV 101 Synechococcus elonga...
P12407   34 LDTNLINLAIIITVLFVFGRKVLGNTLKTRRENIETAIKNAEQRAADAAKQLKEAQQKLEQAQAEAERIKKSAQDNAQTA 113 Nostoc sp. PCC 7120 ...
P48186   27 LATNLINLTVVVGVLIFFGKGVLKDLLDNRKQRILSTIRNSEELRKGTLEQLEKARIRLQKVELEADEYRMNGYSEIERE 106 Zea mays
Q2RPA7   28 aFWVSIAFLMVVGFVYIKAKNKILGALDGRGAAVKAKLDEARKLRDDAQALLAEYQRRQRDAMKEADEIIRHAKDEAARL 107 Rhodospirillum rubru...
Q329S5    7 ILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKASATDQLKKAKAEAQVIIEQANKRRSQI 86  Shigella dysenteriae...
P12410   26 LPLMAIQFLLLALILNATLYKPLGKAIDGRNEYVRNNQLEAQERLSKAEKLAEAYEQELAGARRQAQTIIADAQAEAQKI 105 Nostoc sp. PCC 7120 ...
P45827   30 FFFVLAIFLVVLGVIGTFVVPPILKVLQERDAMVAKTDADSKMSAAQFAAAQADYEAAMKEARVQSSFLRDNARVDGRKS 109 Mycobacterium leprae TN
Q2RPA6   13 IVWLVIALVAMYFVMSRLAIPRLAEVLEQRQRLINDDLKQAEALKAETEAAIAAYETALAEARARAHDEIRAVTEAAAKA 92  Rhodospirillum rubru...
P27181   27 LEANLFNLAILLGIIIYYAPKTLGKILGDRRQKIADAIEEAETRQRKSAQILAEEEKKLAQAKAEAARIVQEAGQRAEVA 106 Synechocystis sp. PC...
6N2Y_b1  91 KEQIVASARAEAERVKETAKKEIEREKEQAMAALREQVASLSVLIASKVI 140
Q31RF3  102 RQEILDKAAADVERLKATAAQDVSTEQQRVLDELRRYAVAQALSRVETQL 151 Synechococcus elongatus PCC 7942 = FACHB-805
P12407  114 GQAIIAQAAVDIERLQEAGAADLNAELDRAIAQLRQRVVALALQKVESEL 163 Nostoc sp. PCC 7120 = FACHB-418
P48186  107 KENLINATSISLEQLEKSKNETLYFEKQRAMNQVRQQGFQQAVQGALGTL 156 Zea mays
Q2RPA7  108 RAKAEADLEASIRRREQQAVDRIAQAEAQALAQVRNEAVDVAVSAARSLM 157 Rhodospirillum rubrum ATCC 11170
Q329S5   87 LDEAKAEAEQERTKIVAQAQAEIEAERKRAREELRKQVAILAVAGAEKII 136 Shigella dysenteriae Sd197
P12410  106 AAEKVAAAQKEAQAQREQAAGEIEQQKQQALASLEQQVDALSRQILEKLL 155 Nostoc sp. PCC 7120 = FACHB-418
P45827  110 IEEARVRAEQHVVSTLQIAGEQIKRERDAVELDLRAKAGAMSLILASRIL 159 Mycobacterium leprae TN
Q2RPA6   93 AEARNAEVAKALNTRIKDGEARIVQARDEALTHVREVAGAVASDIVGKLA 142 Rhodospirillum rubrum ATCC 11170
P27181  107 KQEIATQTEADLRRMQEAAAQDLGAEQERVIAELKRRIAEQAVAKAEADL 156 Synechocystis sp. PCC 6803 substr. Kazusa
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap