3KB6,2H1S,2YQ5,7JP2,6ABJ,5Z1Z,2P9G,2O4C,5DT9


Conserved Protein Domain Family
2-Hacid_dh

?
pfam00389: 2-Hacid_dh 
Click on image for an interactive view with Cn3D
D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
This family represents the largest portion of the catalytic domain of 2-hydroxyacid dehydrogenases as the NAD binding domain is inserted within the structural domain.
Statistics
?
PSSM-Id: 425656
Aligned: 78 rows
Threshold Bit Score: 135.496
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3KB6_B   4 LFTsv-------pqEDVPFYQEal--kdL--SLKIYTtdvsKVPEN-ELKK------AELISVFVYD-----KLTEELLS 60  Aquifex aeolicus
Q9HK29   4 LVVvpnflpldqirSAVSTITQ---------DVEVRT----------DTDFdr--sdAEILIVTTFT-----PVNGDLLK 57  Thermoplasma acidophilum
Q97U35   3 IISt---------eKVPDECKN---------IISVKD----ENITE----Edy--knAEILLTWPGR------VNNDLIG 48  Saccharolobus solfata...
O14075  10 LLV-----------GTLKHAHKewealgKyaELKTYSdgtrEDFLA-KCKTef--qnVKAICRTYNSkfymgIFDKEIID 75  Schizosaccharomyces p...
O94574  10 LAIgelk----fatNTLKRLSEk-----YhfEFIVPDphdrSKTIE-KIHEaaskstFDACFWLFRNaa-isPFTEEMLG 78  Schizosaccharomyces p...
Q2FVW4   5 YVAgai------peVGLKLLQEh-------fEVEMYEgk-gLVDKD-TLIKgv--knATALISLLST-----NVDKDVID 62  Staphylococcus aureus...
Q9A244  25 IVTrklpd--pvetRMCELFDT---------ELNVSDk---PMTAD-ELVDam--srADVLVPTITD-----RIDSRLLS 82  Caulobacter vibrioides
Q9HXB7   6 FVFsrl------apEHLERLQC---------QFNVRVlepkQGDIDaQYAAal--pdTHGMIGVGRP------LGARQLE 62  Pseudomonas aeruginosa
Q9CA90   7 LMMc---------pMSSYLENEl--------EKRFNLlrfwTSPEK-SVLLethrnsIRAVVGNASA-----GADAQLIS 63  thale cress
Q9LE33  10 VLLhr--------pPSLTFMDEi-------lTREFRTlitdTSSSE-SLPSffprhaSSARAFVISGr---lPVTDELLS 70  thale cress
3KB6_B  61 KX-PRLKLIHTRSVGFDHIDLDYCKKKGILVTHIPAYSPESVAEHTFAXILTLVKRLKRIEDRVKKLNFSQDSEILAREL 139 Aquifex aeolicus
Q9HK29  58 KM-PRLRFVQVASIGYDNVDMNAMKKNGIMVSNIPTASADSVAEHALSMVLSLIKDQRFLDAEIRSGRWPRITRSSDLMG 136 Thermoplasma acidophilum
Q97U35  49 KM-PNLKVIQTFSAGVDDLDFSIIPSH-VKVFSNAGAYSLSVAEHAWALILASAKGVGTKKRTIVYDVSEKTLLILGGGG 126 Saccharolobus solfata...
O14075  76 NLpPSVKFICHLGAGYETVDVAACTARGIQVSHVPKAVDDATADVGIFLMLGALRGFNQGIFELHKNNWNANCKPSHDPE 155 Schizosaccharomyces p...
O94574  79 PLlPTCKLFVTGAAGYNNVDVDWATRNGVYVANTPNGPTEGTANMNLMLFMCTLRGAREAEQSLRLGKWRQNLSLTDDPY 158 Schizosaccharomyces p...
Q2FVW4  63 AG-KDLKIIANYGAGFNNIDIEYAREKSIDVTNTPKASTNATADLTIGLVLAVARRIVEGDQLSRTTGFDGWAPLFFRGR 141 Staphylococcus aureus...
Q9A244  83 RSgDRLKLIANFGAGVDNIDVATANARGIIVTNTPGVLTEDTADLTMTLIMAASRRIVEGAEVVKAGGFHGWSPTWMMGR 162 Caulobacter vibrioides
Q9HXB7  63 QA-KQLEVISSVSVGYDNYDLDYLNRRGIALTNTPDVLTETTADLGFALLISAARRVAELDAWVKAGNWKRTVDAPQFGT 141 Pseudomonas aeruginosa
Q9CA90  64 DL-PNLEIVSSFSVGLDKIDLGKCKEKGIRVTNTPDVLTEDVADLAIGLILALLRRLCECDRYVRSGKWKQGEFQLTTKF 142 thale cress
Q9LE33  71 HL-PSLQILVCTSVGIDHIDLAACKRRGIVITNAGNAFSDDVADCAVGLLISVLRRIPAADRYVRSGNWAKFGDFQLGSK 149 thale cress
3KB6_B 140 NRLTLGVIGTGRIGSRVAXYGLAFGXKVLCYDVVKREDLKEKGCVYTSLDELLKEsdvislhvpytkETHHXINEERISL 219 Aquifex aeolicus
Q9HK29 137 KTFGIVGMGSIGRALAARLLPFKVAIIYNDTKRMSEAEEEEYGATFVSLDRLL----------------SDSDVISVHVP 200 Thermoplasma acidophilum
Q97U35 127 IGSEVARIGKTAFRNYVIGISRSFKKPEWFDERHGMTMLREKIGEADIIV----------------------DTLPLNKQ 184 Saccharolobus solfata...
O14075 156 GKTLGILGLGGIGKTMAKRARAFDMKIVYHNRTPLPEEEAEGAEFVSFDDLLA-----------------KSDVLSLNLP 218 Schizosaccharomyces p...
O94574 159 GKRVGIIGMGAIGKSFAQKILPLGCEIVYHNRNRLEAEEEKRLGASFVSFDELL---------------SSSDVISINCP 223 Schizosaccharomyces p...
Q2FVW4 142 EVSGKTIGIIGLGEIGSAVARRARAFDMDVLYTGPNRKEEKEREIGAKYVDLDTL-------------LKNADFITINAA 208 Staphylococcus aureus...
Q9A244 163 RLWGKRLGIIGMGRIGQAVARRAKAFGMQVHYHNRKPVSPRIAEELGCTYWESLDq-----------MLARMDFVSVNCP 231 Caulobacter vibrioides
Q9HXB7 142 DVHGKKLGILGLGRIGAAIARRGRFGFGMQVLYHGNNRKPELEQELGARFLGFDE------------LLGEADFVCVVVP 209 Pseudomonas aeruginosa
Q9CA90 143 SGKSVGIIGLGRIGTAIAKRAEAFSCPINYYSRTIKPDVAYKYYPTVVDLAQ------------------NSDILVVACP 204 thale cress
Q9LE33 150 VSGKRVGIVGLGSIGSFVAKRLESFGCVISYNSRSQKQSSPYRYYSDILSLAE-----------------NNDVLVLCCS 212 thale cress
3KB6_B 220 XKDGVYLINTARGKVVDTDALYRAYQRGKFSGLGLDVFEDEEILILKKYTEGKATDKNLKILELACKDNVIITPHIAYY- 298 Aquifex aeolicus
Q9HK29 201 LNETTRHMFNSSRFGLMKDGAIFINTSRGEVVVEKDLIEAIQKKGIRAGLDVFEHEPPDPNSPLFRLENTLFSPHIAGV- 279 Thermoplasma acidophilum
Q97U35 185 TRGLLSYDLLKDIRRNAIIVNVGRGETVDEEGIYKLLKERQDVRFGTDVFWRKNGKEDFYNTKLWELDNFTGTLHTAGAy 264 Saccharolobus solfata...
O14075 219 LNAHTRHIIGKPEFQKMKRGIVIVNTARGAVMDEAALVEALDEGIVYSAGLDVFEEEPKIHPGLLENEKVILLPHLGTN- 297 Schizosaccharomyces p...
O94574 224 LTPATHDLISTKEFEKMKDGVYIINTARGAIINEDAFIKAIKSGKVARAGLDVFLNEPTPNKFWLECDKVTIQPHCGVY- 302 Schizosaccharomyces p...
Q2FVW4 209 YNPKMHHLIDTEQFKMMKSTAYLINASRGPIVHEQALVQALKDNEIEGAALDVYEFEPDITDDLKSLNNVVLTPHIGNA- 287 Staphylococcus aureus...
Q9A244 232 HTPATYHLLSARRLKLLRPHAVVVNTARGEVIDEGALANMLAKGEIAGAGLDVYEHEPAINPKLLKLPNVVLLPHMGSA- 310 Caulobacter vibrioides
Q9HXB7 210 LGAQTRQLIGARELGLMKPSAILVNVARGQVVDEAALVAALREKRILGAGLDVYEKEPLAESPLFALDNVVTLPHIGSA- 288 Pseudomonas aeruginosa
Q9CA90 205 LTEQTRHIVDRQVMDALGAKGVLINIGRGPHVDEQELIKALTEGRLGGAALDVFEQEPHVPEELFGLENVVLLPHVGSG- 283 thale cress
Q9LE33 213 LTDETHHIVNREVMELLGKDGVVINVGRGKLIDEKEMVKCLVDGVIGGAGLDVFENEPAVPQELFGLDNVVLSPHFAVA- 291 thale cress
3KB6_B 299 -TDKSLERIREETVKVVKAFVKGdleqIKGNFVVG 332 Aquifex aeolicus
Q9HK29 280 -TAESQMRFFRETIANVMRYMQG----YDPNFRVI 309 Thermoplasma acidophilum
Q97U35 265 gNESIMKRAMLIACLNVKKYIDR----GIADNEVR 295 Saccharolobus solfataricus
O14075 298 -SLETQYKMECAVLMNVKNGIVN----DSLPNLVP 327 Schizosaccharomyces pombe 972h-
O94574 303 -TNFTVAKTEECVLASIETFLDT----GIPTNPVN 332 Schizosaccharomyces pombe 972h-
Q2FVW4 288 -TFEARDMMSKIVANAAISAVQG----EKPQFVVN 317 Staphylococcus aureus subsp. aureus NCTC 8325
Q9A244 311 -TVEGRIDMGEKVIVNVKTFMDG----HRPPDRVI 340 Caulobacter vibrioides
Q9HXB7 289 -THETRRAMAERALQNFEAALRG----ERPLDLVN 318 Pseudomonas aeruginosa
Q9CA90 284 -TVETRNAMADLVVGNLEAHFSG----KSLLTPVV 313 thale cress
Q9LE33 292 -TPGSLDNVAQIALANLKAFFSN----RPLLSPVQ 321 thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap