2GQ1,7NS3


Conserved Protein Domain Family
FBPase

?
pfam00316: FBPase 
Click on image for an interactive view with Cn3D
Fructose-1-6-bisphosphatase, N-terminal domain
This family represents the N-terminus of this protein family.
Statistics
?
PSSM-Id: 425601
Aligned: 9 rows
Threshold Bit Score: 250.069
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2GQ1_A         2 KTLGEFIVEKQHEFS-HATGE-----LTALLSAIKLGAKIIHRDINKAGLVDILGASGAENVQGEVQQKLDLFANEKLKA 75 
XP_002891265  13 MTITRFVLNEQSKYP-ESRGD-----FTILLSHIVLGCKFVCSAVNKAGLAKLIGLAGETNIQGEEQKKLDVLSNDVFVK 86 
P46283        69 STVTKCEIGQSLEEF--LAQAtpdkgLRTLLMCMGEALRTIAFKVRTAS----CGGTACVNSFGDEQLAVDMLADKLLFE 142 thale cress
XP_002820025  12 nTLTRFVMEEGRKAR--GTGE-----LTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGSTNVTGDQVKKLDVLSNDLVMN 84 
Q05079        19 ITLSRFILDQQHLSAkNATGE-----FSMLLNSLQFAFKFISQTIRRAELVNLIGLAGASNSTGDQQKKLDVLGDEIFIN 93  Kluyveromyces l...
P09201        21 ITLPRFIIEHQKQFK-NATGD-----FTLVLNALQFAFKFVSHTIRRAELVNLVGLAGASNFTGDQQKKLDVLGDEIFIN 94  Saccharomyces c...
Q328V4         2 kTLGEFIVEKQHEFS-HATGE-----LTALLSAIKLGAKIIHRDINKAGLVDILGASGAENVQGEVQQKLDLFANEKLKA 75  Shigella dysent...
P45292         2 KTLSEFIVERQAEYP-NAKGE-----LSGILSSIRLLAKIIHRDINKAGLTNILGQSGIENVQGESQMKLDLFAHNTMKA 75  Haemophilus inf...
7NS3_Fb       21 ITLPRFIIEHQKQFK-NATGD-----FTLVLNALQFAFKFVSHTIRRAELVNLVGLAGASNFTGDQQKKLDVLGDEIFIN 94 
2GQ1_A        76 ALKARDIVAGIASEEEDEIVVF--EGCEHAKYVVLXDPLDGSSNIDVNVSVGTIFSIYRRV-------TpVGTPVTEeDF 146
XP_002891265  87 ALVSSGRTSVLVSEEDEEATFV--EPSKRGKYCVVFDPLDGSSNIDCGVSIGTIFGIYTLD-------H-TDEPTTE-DV 155
P46283       143 ALQYSHVCKYACSEEVPELQDM--GGPVEGGFSVAFDPLDGSSIVDTNFTVGTIFGVWP-----------GDKLTGI--- 206 thale cress
XP_002820025  85 MLKSSFATCVLVSEEDKHAIIV--EPEKRGKYVVCFDPLDGSSNIDCLVSIGTIFGIYRKK-------S-TDEPSEK-DA 153
Q05079        94 AMKASGNVKVLVSEEQEDLIVF---RNSPGKYAVCCDPIDGSSNLDAGVSVGTIVSLFKihenqngnsgeEDSEGTInDV 170 Kluyveromyces l...
P09201        95 AMRASGIIKVLVSEEQEDLIVF---PTNTGSYAVCCDPIDGSSNLDAGVSVGTIASIFRl---------lPDSSGTInDV 162 Saccharomyces c...
Q328V4        76 ALKARDIVAGIASEEEDEIVVF--EGCEHAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRRV-------TpVGTPVTEeDF 146 Shigella dysent...
P45292        76 ALMAREEVAGFASEEEESFIAFdtERGRNAKYIILTDPLDGSSNIDVNVSVGTIFSIYRRV-------SpIGSPVTLeDF 148 Haemophilus inf...
7NS3_Fb       95 AMRASGIIKVLVSEEQEDLIVF---PTNTGSYAVCCDPIDGSSNLDAGVSVGTIASIFRLl---------PDSSGTInDV 162
2GQ1_A       147 LQPGNKQVAAGYVVYGSSTXLVYTTGC--GVHAFTYDPSLGVFCLCQE 192
XP_002891265 156 LKPGNEMVAAGYCMYGSSCMLVLSTGT--GVHGFTLDPSLGEFILTHP 201
P46283       207 --TGGDQVAAAMGIYGPRTTYVLAVKGfpGTHEFLL-LDEGKWQHVKE 251 thale cress
XP_002820025 154 LQPGRNLVAAGYALYGSATMLVLAMDC--GVNCFMLDPAIGEFILVDK 199
Q05079       171 ARCGREMVAACYTMYGASTHLVLTTGA--GVNGFTLDNNLGEFILTYP 216 Kluyveromyces lactis NRRL Y-1140
P09201       163 LRCGKEMVAACYAMYGSSTHLVLTLGD--GVDGFTLDTNLGEFILTHP 208 Saccharomyces cerevisiae S288C
Q328V4       147 LQPGNKQVAAGYVVYGSSTMLVYTTGC--GVHAFTYDPSLGVFCLCQE 192 Shigella dysenteriae Sd197
P45292       149 MQPGNKQVAAGYIVYGSSTMLVYTTGN--GVNGFTYDPSIGTFCLSHE 194 Haemophilus influenzae Rd KW20
7NS3_Fb      163 LRCGKEMVAACYAMYGSSTHLVLTLGD--GVDGFTLDTNLGEFILTHP 208
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap