1NOC


Conserved Protein Domain Family
CAT

?
pfam00302: CAT 
Click on image for an interactive view with Cn3D
Chloramphenicol acetyltransferase
Statistics
?
PSSM-Id: 425592
Aligned: 7 rows
Threshold Bit Score: 334.016
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1NOC_B                10 TVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFLKTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDg-ELVIWDSV 88 
WP_004903992           5 RIDLNTWNRREHFALYRQQIKCGFSLTTKLDITASRTALTETGYKFYPLMIYLISRAVNQFPEFRMAMKDn-ELIYWDQS 83  Morganella
WP_000412211          10 TVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFLKTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDg-ELVIWDSV 88  eubacteria
ABV61815               4 QID-ENYLRKEHFHHYMKVTRCSYSLVIDLDITKLHSIIKEKKLKVYPVQIYLLARAVQKIPEFRMDLVNd-ELGHWELL 81 
goetting:Cspa_c34740   5 LIDINHWSRKPYFEHYLNTVKCTYSMTANIEITDLLYEIKLKNIKFYPTLIYMIATVVNNHKEFRICFDHkgSLGYWDSM 84 
EQC76590               5 IIELENWDRKEYFEHYFN-QQTTYSITKEIDITLFKDMIKKKGYEIYPSLIYAIMEVVNKNKVFRTGINSenKLGYWDKL 83 
WP_023420183          10 PVDLDTWPRRQHFAHYRRRVPCTYAMTVEVDVTTFAAELRRSPRKSYLAQVWALATVVNRHDEFRMCLTAsgDPAVWPVV 89  unclass...
1NOC_B                89 HPCYTVFHEQTETFSSLWSEYHDDFRQFLHIYSQDVACYGENLAYFPKG-FIENMFFVSANPWVSFTSFDLNVANMDNFF 167
WP_004903992          84 DPVFTVFHKETETFSVLSCRYFPDLSEFMAGYNAVTAEHQHDTGLFPQGnLPENHLNISSLPWVSFDGFNLNITGNDDYF 163 Morganella
WP_000412211          89 HPCYTVFHEQTETFSSLWSEYHDDFRQFLHIYSQDVACYGENLAYFPKG-FIENMFFVSANPWVSFTSFDLNVANMDNFF 167 eubacteria
ABV61815              82 HPSYTILNKETKTFLSIWTPYDENFAQFYKSCVADIETFSKSSKLFPKShMPENMFNISSLPWIDFTSFNLNVSTDEAYL 161
goetting:Cspa_c34740  85 NPSYTIFYKENETFSSIWTEYNESFLRFYSDYIDDIKNYGNIMKFTPKSnEPDNIFPVSSIPWVSFTGFNLNVYNEGTYL 164
EQC76590              84 NPLYTVFNKQTEKFTNIWTESDKNFISFYNNYKNDLLEYKDKEEMFPKKpIPENTIPISMIPWIDFSSFNLNIGNNSSFL 163
WP_023420183          90 HPAFTVFNPRRETFACVWAPYDPDFGTFHDTAAPLLAEHSRATDFFPQGdPLPNTFDVSSLPWASFTGFTLDIRDSWDHL 169 unclass...
1NOC_B               168 APVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQ 209
WP_004903992         164 APVFTMAKFQQEGDRVLLPVSVQVHHAVCDGFHAARFINTLQ 205 Morganella
WP_000412211         168 APVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQ 209 eubacteria
ABV61815             162 LPIFTIGKFKVEEGKIILPVAIQVHHAVCDGYHVGQYVEYLR 203
goetting:Cspa_c34740 165 IPIFTAGKYFKQENKIFIPISIQVHHAVCDGYHASRFINEMQ 206
EQC76590             164 LPIITIGKFYSENNKIYIPVALQLHHSVCDGYHASLFMNEFQ 205
WP_023420183         170 APIFTLGRYTRRDARLLLPLSVQIHHAAADGFHTARLTGELQ 211 unclassified Streptomyces
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap