3KX6


Conserved Protein Domain Family
Glycolytic

?
pfam00274: Glycolytic 
Click on image for an interactive view with Cn3D
Fructose-bisphosphate aldolase class-I
Statistics
?
PSSM-Id: 425574
Aligned: 65 rows
Threshold Bit Score: 519.772
Created: 26-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3KX6_B        33 ELAENASFIASPGKGILAADESTGTIQKRFDNVGVENTEKNRAEYRSILFTTKG-LGKYISGCILFEETLFQQAPNGQNM 111 Babesia bovis
XP_009010771  16 ELRRIARALIAPGKGILAADESNASMHKRLDMIKMENNEENRRKFREMLLCCGKeMSEHIGGCILFHETLYQKANDGVPF 95  Helobdella robusta
CDS42102      25 ELEATANALIICGKGILATDETPATLGVRFSSINLENTPENRRRYRELLYATDCsIKKYISGIIMHPESLNEQASDGKPM 104 Echinococcus mu...
EJD76644      67 ELRQIANQIVAPGKGILAADESTGSMDKKLKPIGLENVEENRRLYRQLLFTAGDeMSKYISGVIMFHETFYQKGDDGTPF 146 eye worm
PIC40559      15 ELRSIANAIVAPGKGILAADESTGSMEKRLTSIGLENNEENRRKYRQLLFTAGAdLNKYISGVIMFHETFYQKTDDGKPF 94  Caenorhabditis ...
XP_002053415  15 ELSCTAKALVAPGKGVITADESASTMGKRFQLIGVENTEENRRLYRQLLFTTDPkISENVSGVIMFHETLYQKTDGGVPF 94  Drosophila virilis
XP_002073136  15 ELICIARALVTPGKGILTVDESTAVCGRYLQSIGLENTEENRRNYRQLLFTSEAkIAENISGVLLFHETLYQKTDDGVPF 94  Drosophila will...
EDW33965      15 ELSCIAKGLVAPGKGILAVDETSSQMGKRLELIGVENTEENRRLYRQILFTTDAkIAENISGVIFPPEALHQKTDDSVPF 94  Drosophila pers...
XP_001967457  15 ELTCISKALVAPGKGILAADESSSVMGKRFQLIGVENTEENRRIYRQMLFTTDPkISENISGVIFYHETLHQRTDDGVPF 94  Drosophila anan...
1_pfamImport   1 ELADIVHQMVCQGKGILVIDDSVCTMNKRLGCLGIDNNEENRRLFRQLFVTADDeIRNYVGGVILSHETFYQKCDDGRTF 80 
3KX6_B       112 VDLLRAEGILPGIKVDKGLVTIPNTdEEVSTTGLDGLAERCQKYYNAGARFAKWRAVLSIDVkkNKPSNLSILETAHTLA 191 Babesia bovis
XP_009010771  96 VKHLQQNGVVPGIKVDMGVVPLAGSdAETTTQGLDNLAERCAQYKKDGAHFTKWRCTLKIQQ--FTPTYQAMIENANVLA 173 Helobdella robusta
CDS42102     105 IELITNRHIIPGIKVNREFVVLPGTfDECTTEGLDELARRCEEYRRRGCRFAKWRCVFKISA--PTPSHLALIEIANVLA 182 Echinococcus mu...
EJD76644     147 VQILQKKGILPGIKVDKGVVPMAGTvGEGTTQGLDDLNSRCAQYKKDGAQFAKWRCVHKIGA--TTPSHMALVEIAEVLA 224 eye worm
PIC40559      95 TALLQEQGIIPGIKVDKGVIPLAGTiGEGTTQGLDDLNARCAQYKKDGAQFAKWRCVHKISS--TTPSVTALKEVAQVLA 172 Caenorhabditis ...
XP_002053415  95 AEVLRKKGIIPGIKVDKNSVPLFCSmDEYTTQGLDDLHLRCAQYKKDGCDFAKWRCVIKIDK--NTPSYQALMENANVLA 172 Drosophila virilis
XP_002073136  95 VEVLRKKGIIPGIKVDKSCVPLFGSeDEYTTQGLDDLATRCAQYKKEGCDFAKWRCALRISK--NTPSHQAIIENANVLA 172 Drosophila will...
EDW33965      95 ADVLRKKGILTGIKVDKQFVALFGSeDEFTTQGLDDLAARCSQYKKEGCSFAKWRCVLKISK--NTPSHQAILENANVLA 172 Drosophila pers...
XP_001967457  95 VEVLKKKGILTGIKVDKHFTPLFGSeDEYTTQGLDDLANRCAQYKKEGCSFAKWRCVLKISK--NTPSPQAILENSNVLA 172 Drosophila anan...
1_pfamImport  81 PEAIKAKNTAVGIKLDRGVVPLAGTnNETTTQGLDGLSERCAQYKKDGADFAKWRCILKIGE--HTPSSLAIMENANVLG 158
3KX6_B       192 RYAAICQENGLVPIVEPEILADGDHSIEVCAEVTERVLAAVFKALNDHKVLLEGALLKPNMVTQGVDCKDK-PAPQTVGF 270 Babesia bovis
XP_009010771 174 RYASISQQNRLVPIIEPEILPDGNHDIETTKEIAEKVLQFVMHSLAIHNVFLEGLLLKVAMVTPGFKCPKR-NTADEIAS 252 Helobdella robusta
CDS42102     183 RYAAISQLAGLVPLIEPEVVTEGNHNIKTAQRVCQEVLSYVFKTLQDHHIFLEGLLIETNFVRAGHTSCCQ-SSVEDNAK 261 Echinococcus mu...
EJD76644     225 RYASICQQHGLVPIVEPETLPDGEHDLHRCQKVTELVLSYTYKALIDHHVYLEGTLLKPNMCMPGMQFKGQ-CSHEDIAR 303 eye worm
PIC40559     173 RYASICQQNGLVPIVEPEILPDGEHDLARGQKITETVLSYVYHALNEHHVFLEGTLLKPNMVTSGQSFTGEkPSNADIGL 252 Caenorhabditis ...
XP_002053415 173 RYAAICQSQRMVPIIEPEVLVNGDHDLDRCQKVTEALLAAVFKSLNDHHIYLEGILLRPNMVTAGQNSNKN-NTPAEIGM 251 Drosophila virilis
XP_002073136 173 RYASICQSQRLVPIIEVEIIPNGDHDMDRAQKVMETVLSALYKSLHDHHIFLEGTLLRPNMVTAGKDSNKT-NIPQEIAM 251 Drosophila will...
EDW33965     173 RYAATCQSQGLVPIINPDILAVGEHDLDRCQKVAETVLAAVYKSLNDHHIFLEGTLLQPSIVTPGMQSQKS-TLPADIGL 251 Drosophila pers...
XP_001967457 173 RYAAICQSQRLVPIISPEILATGDHDLDRCQKVTEILLTGVYKALSEHHVFLEGTLLQPSMVTPGLQSNKN-HPPSDIGL 251 Drosophila anan...
1_pfamImport 159 RYASVCQQNGLVPLIEPDILTDGNHNLKQAQFITEKVLASVFKALSDHHIFLEGSILQVNMVLPGHDCSQR-YCPEDIAM 237
3KX6_B       271 LTSRALRRTVPPALPGVMFLSGGQSESMATRHLNEINKCNK-HPWSLSFSYGRALQSSVLKTWNGSMSNAAAAQDVLMKL 349 Babesia bovis
XP_009010771 253 FTLSALQRRIPPAIPGIVFLSGGMAEDEATANLNAMNKLPN-RPWALSFSFARALQTSATLIWHGKEENQKAAREEMLKI 331 Helobdella robusta
CDS42102     262 TTLEVLQRTVPPAVPGILFLSGGLSEDDATLNLNAINTIESkRPWALTFSFGRAMHNAVLTAWKGVDDNIPNAQCVLMRL 341 Echinococcus mu...
EJD76644     304 ATVTALQRTVPVAVPGVVFLSGGQSEEDATLNLNAINQFPGkKPWALTFSYGRALQASALAAWGGKPENIQAAKEAFLKR 383 eye worm
PIC40559     253 ATVTALQRGVPSAVPGVVFLSGGQSEEDATKNLNAINQVTGkKPWALTFSYGRALQASCLAKWAGKDENIAAAQEVLLHR 332 Caenorhabditis ...
XP_002053415 252 ATILALRRTVPPAVPGIMFLSGGMSEEEATVNLNATNNVPLcKPWALTFSFGRAMQASAMRSWGGKKDNVLTAQSELIKR 331 Drosophila virilis
XP_002073136 252 ATVLAIRRTVPPAVPGVMFLSGGMSEEESSVNLHAINNVPLcKPWALSFAFGRSMQASVLKCWSGRKDNVQNAQIELIKR 331 Drosophila will...
EDW33965     252 CTVLAIRRTVPPAVPGVMFCSGNQSEEEATVNLNAINNVPLcKPWAMTFAFDRALQSSVLRTWGGRKDNVVNAQNELIKR 331 Drosophila pers...
XP_001967457 252 ATVLSIRRTVPPAVPGVLFCSGTQSEEEATVYLNAINNVPLcKPWAMSFAFDRALQTSILRTWGGKKEQITHAQNELLKR 331 Drosophila anan...
1_pfamImport 238 ATISALRNTVPPAVPAVAFLSGGQNEDDATVLLNAINKCSLpKSWILTFSYGRPLQSSPAKIWAGKDSHVKPAQQEYIRR 317
3KX6_B       350 AQQNSEASLGSL-K---TDLSDDGESLFEAKYIY 379 Babesia bovis
XP_009010771 332 AKANGLATLGKF-Qg-nLKTFASGKNTFVADNAY 363 Helobdella robusta
CDS42102     342 ARQNSQASMGFY-K---VLGRAAPEK-----SSE 366 Echinococcus multilocularis
EJD76644     384 AQANSLAQLGKY-Tg-gAGSGAAAQNLYVANHAY 415 eye worm
PIC40559     333 AQVNSLASVGKY-TgdaSADAAASQSLFVANHAY 365 Caenorhabditis nigoni
XP_002053415 332 AKANSLASIGKYvPg-sVEGSAGAEKLIVD--AY 362 Drosophila virilis
XP_002073136 332 AKANSLASIGKYvAg-sVESVAANEKLFAE--SI 362 Drosophila willistoni
EDW33965     332 CKANSLASIGKYiPg-sVEGSAGTEKLifdaley 364 Drosophila persimilis
XP_001967457 332 CKANSLACIGKYvHg-sIESSAGTERllleaief 364 Drosophila ananassae
1_pfamImport 318 AKAVSQASEGKY-Cp-pSSGRGMSHA---SEQLF 346
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap