6YNW,5LQZ,6CP6,5FL7,6OQR


Conserved Protein Domain Family
ATP-synt

?
pfam00231: ATP-synt 
Click on image for an interactive view with Cn3D
ATP synthase
Statistics
?
PSSM-Id: 459722
Aligned: 851 rows
Threshold Bit Score: 80.6479
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6YNW_g         25 NLKQLKIRMKAIGSIKKITKAMKMVAASKMKAETSRLENGRNFAvGSVQKMLEnesyvqkkksttapksTL--------- 95  Tetrahymena th...
WP_012675912    3 STKDIELKIKKFDDIRKIVISMKSIASLNLQKAQHLITSLRDYE-SEITDSLQ----------------KIlsfypdlsl 65  Persephonella ...
WP_013836746    4 rLAEVEARIESVHQLSSVIGAVRAIAAARLREAKARLPGIQTYA-RTIGEAIA----------------QAlalvpqapa 66  Novosphingobiu...
jgi:Bphy_1121   4 rLSEIEGRMATAHQLDAVIGAMRGIAAAREREAQARLAGIRSVA-ATVGEAIG----------------RVlaatehqgs 66 
Q63IX1          4 kLAAIEARTDTARQLQTVIGAMQGVAAARAHEAQQRLPGIRASA-ATVGAAIG----------------DAlsagarsge 66  Burkholderia p...
Q13XW0          4 rLAEIEARTATARQLDAVIGAMRGIAAARSREAQRRLPGIRSSA-ATVGAAIG----------------AVlaygrgaqa 66  Paraburkholder...
jgi:Bind_2780   4 rLSDVAARIHSVRQLSAVITAMRGIAASRSREARSQLDGVRAYA-QTIAEAIG----------------HAlaflperpq 66 
WP_012963596    2 RLKDIDNKINHLYSVKKYINAMNLISINRYRRYYAQLSAQHRYF-LRLREVLE----------------MLiylhrgdlf 64  Hydrogenobacte...
B8DYT1          3 TLQGLRRKVKTIQNISHIIHSMETLSMVKIRALQDKSLRLKPYT-EELNNILM----------------ELitrlpneyl 65  Dictyoglomus t...
Q8YAM7          3 SIDQARKTIKALNSTYKIVHVTELATLGKLSALREKAEAAVSYY-ETILKSLRwvrktmytsn----------------- 64  Listeria monoc...
6YNW_g         96 --------------LVPITSDKGLCGSVNSSIVREVkRlALNnRSa--------fGLLPVGEKGSS--------GLSrPf 145 Tetrahymena th...
WP_012675912   66 ------sfnegkkaVIVYGSDQGLCGLFNEKIGREVlS-KFSdDPdf-------aGFIVVGKKLDDv------iSDRkF- 124 Persephonella ...
WP_013836746   67 n---aakggnrksiVLAIGAEQGFVGNFNGRLLDALtPlTRSsRTps-------cELLLVGSHAASa------------- 123 Novosphingobiu...
jgi:Bphy_1121  67 re--spperylapvLIVLCTEQGFVGAFNERLLECVeSwPSHgTA----------TLFVVGTRGAAl------------- 121
Q63IX1         67 ta-agaraaprarlVVVLCSEQGFVGAYNAQLIEHAtRpGPSvSR----------EYMMVGSRGAMl------------- 122 Burkholderia p...
Q13XW0         67 p---saepdhgvriVIALCSEQGFVGSFNEQVLDYVrTrVDSaRC----------ELLLVGTRGEMa------------- 120 Paraburkholder...
jgi:Bind_2780  67 te--pagraaqghgIIALCAEQGFAGTFNERVLDAAgRlISAaPDrr-------tALLLVGDRGLMv------------- 124
WP_012963596   65 -----lkrkekslcLILLSTDRGFVGRFNEVLIRTV-------SDflkhpplevkKVVIVGRRGAQqfk--nmeKTEtY- 129 Hydrogenobacte...
B8DYT1         66 nhplirersvyktgILVFTSDLGFCGSYNLQIIESL-K-KFIegkr-----aqnlVFYSIGFYAQRylssnnfnIRKkY- 137 Dictyoglomus t...
Q8YAM7         65 ----nqikeeknvtAIAITSERGLCGAYNSEVFAEIdQ-LIEsLGdqv-----tiNWVVVGEQGHRyltk---------- 124 Listeria monoc...
6YNW_g        146 pdllKSsivnIq--nVN---FPTAAA-IAHQVstqgagYD------------QVT------------------------- 182 Tetrahymena th...
WP_012675912  125 ----KTf--------PSpvdYDSIYS-YASELig---yITqlyis---ekinEIY------------------------- 160 Persephonella ...
WP_013836746  124 ---aSErvltVnwsaPMathAQEIAG-LANRI------ADalfdriangevsEVL------------------------- 168 Novosphingobiu...
jgi:Bphy_1121 122 ---aDErglvYdwsvPMashAGDVMR-VAGRI------SDavfarfdahpasAIW------------------------- 166
Q63IX1        123 ---aDAggvpLvwrtPMaarADDVVH-LANRI------TDalyahlakrgaqPVS------------------------- 167 Burkholderia p...
Q13XW0        121 ---aSErrlaLawssPAvshADEVPS-LANRI------TDalyarlglravdQVS------------------------- 165 Paraburkholder...
jgi:Bind_2780 125 ---aRErglaIawsaPMaahAGQAAS-LANQI------VEelyrridgdhmtRIS------------------------- 169
WP_012963596  130 ----TG----VfgkdID---WGKAQE-IFYSI------VRdyma----ghydAVYvalnrpilrqamreekaerevkkee 187 Hydrogenobacte...
B8DYT1        138 ----IK----Fle-dTS---FSQAKI-LSKDL------LDdfln----yvidELY------------------------- 169 Dictyoglomus t...
Q8YAM7        125 lgqnITsylqFslenIDletTTAVTAdFIDLIhse--------------qmdALY------------------------- 165 Listeria monoc...
6YNW_g        183 -----LIYNHFKN-----------AISYVVKHQELLPraq-----------flnLFkyvtrheavEPeL----EYS-KNY 230 Tetrahymena th...
WP_012675912  161 -----VSYNQFMG-----------IGRYRPVIKRIIPfeverenl--yryppvvDI---------DP------AQI-LSD 206 Persephonella ...
WP_013836746  169 -----LVHAATDAq----------QPESPVQVRPLLPfdfsrfa---------------plaraqPPiIqlppERL-LAQ 217 Novosphingobiu...
jgi:Bphy_1121 167 -----LIHALAKE-----------GAQVAVVTRRLVPfdfdrfk---------------sgprlrLPlLtlptGKM-LAG 214
Q63IX1        168 -----IVHAMPGG-----------AARLEVTERRLLPfdyarfd---------------tapraqPPlVhlppATL-LAE 215 Burkholderia p...
Q13XW0        166 -----IIHALPGGg----------AASGKMVEHRLIPfdfsrfq---------------varravPPlLtlpvERL-LPG 214 Paraburkholder...
jgi:Bind_2780 170 -----IVHAVPGP-----------SAAVNIAEKVLVPfdfgrfp---------------lahgavHPlItlppDIL-LAR 217
WP_012963596  188 aqvgeIFYELFKRatptlpvavgtVASYKPQIVKFIPpalegs------yseksIM------------NfegdEEFiLME 249 Hydrogenobacte...
B8DYT1        170 -----VIYFEFIN-----------IVKQEVRIKKILPmipvevk---erkeeyfLF---------LP-Sl---SSI-LDP 216 Dictyoglomus t...
Q8YAM7        166 -----VIFTKYLN-----------AVQSEAMCEKIYPeipedsdtelievdyvlDF---------ETdD----EQV-EQL 215 Listeria monoc...
6YNW_g        231 FFELYMASSVYNALLNSSASEQASRMNAMENASKNAGEILSKLTLDYNKARQAKITMELIEIISGASI 298 Tetrahymena thermophila
WP_012675912  207 IIIEYIFANIYRSYLESFLSENGVRLMNMDNASKSIEKNIKNLEIERNYFRQEEITDEIQEIISAyrv 274 Persephonella marina
WP_013836746  218 LADEYVFAEICEALVLSFAAENEARMQAMVAARENVARRSDELAARARLMRQEQITEEVIELASGGAs 285 Novosphingobium sp. PP1Y
jgi:Bphy_1121 215 LAERYVYVELCEGLMLSFAAENAARMTAMLAASDHVGETLKALTREARIVRQDEITTEIVELAvasap 282
Q63IX1        216 LAQAYVFVELCEAAMLAFAAENEARTRAMIAARESVERALGDLLQAYRIARQDEITADIVELAAsgl- 282 Burkholderia pseudomallei
Q13XW0        215 LVEEYVFVEICEALMLSFAAENEARVNAMLAARTNVRDTLEELTQSYRRVRQDEITDDIAELAAAttq 282 Paraburkholderia xenovoran...
jgi:Bind_2780 218 LAEEYIFAELCEAVMLSFAAENEARMRAMIAAKTNVAKTLDGLIARSRQLRQEEITNEILELDSGASs 285
WP_012963596  250 LLRLYLYFLLRQIFLEHFSAELSARFIKTREIIRAIDKKVSQLSFERNKLRQERINNELLDLIniyis 317 Hydrogenobacter thermophilus
B8DYT1        217 LLMDIFETQIHQIMLDSAASEQAFRRFAMKRAYDNAQKLHSKLIFQLNQLRQTQITKELLDITSSIEA 284 Dictyoglomus turgidum DSM ...
Q8YAM7        216 LLENYLCGLLYSMFRYSVASEYCMRRIAMKQAKDNIQKQLEEAIFDARKQALQQKTGELLDIISGAQt 283 Listeria monocytogenes
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap