Conserved Protein Domain Family
HSP90

?
pfam00183: HSP90 
Hsp90 protein
Statistics
?
PSSM-Id: 425509
Aligned: 87 rows
Threshold Bit Score: 434.273
Created: 26-Apr-2021
Updated: 29-Sep-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WGS:AAFB:cds.EHI_102270A 195 EYLETKKIQEIIKKHSEFIQYPIMLYVTKETEEEVTddE---AEEKKEEETKee-----dKKEEDVKIE-DDKKEEEk-- 263 Ent...
5_pfamImport               1 EFQDQDKLKSLVGHYSEFINFPIYVNSSSTETYEVE--E---EAEDVEETVEneekdaekSSEEDEELE-AVEEDGEv-- 72 
XP_002185513             240 EYLESSKMQELLQRYSEFIEFPISIWKETTEYKKVPd-E---EA-----------------NKDLPEGE----------- 287 Pha...
EPB92434                 170 rFLQEKNLKELVHKYSQFITFPIMVWSGQEEEVPVSe-E---DS-----------------SSNDDVVE-ESIDDDK--- 224 Muc...
CBZ12407                 220 qFLSAETIKKTIHQYSEFINFPIYV----QEEVEVA------STAATPEPAAe------eGSLDEGAVE-EDSDK----- 277 Lei...
XP_001566424             220 EFLSAETIKKTIHQYSEFINFPIYV----QEEVEVKp-K---TEIRTSEPGAe------vGFMKEVVVE-EDNN------ 278 Lei...
CDS42723                 241 EYLQQDVLRKILKKYSQFVMCPIKLWESQTVNVEEDv-E---EEKVD--------------LSDDISVE-EE-------- 293 Ech...
EFX71215                 258 DFLEVDTIRNLVHKYSQFINFNIYLWTSKTEEVEEPv-D---DEAEPVEDKKa-------EEEEDAKVE-EEAEEK---- 321 com...
EFA78289                 266 EFLNQDTIKSLVKKYSQFINFPISMYVSHQEDAp----E---EETPIDAKPV---------DETEVKVEeEETTDEQeee 329 Het...
XP_001617311             246 nlMNDKKLVDLISKYSQFIQYPIYLLHENVYTEEVLa-DiakEMENDP-------------NYDSVKVE-ESDDP----- 305 mal...
WGS:AAFB:cds.EHI_102270A 264 -------pAKKTKK-VKKVTHEWEQVNKQKPIWTRNPSEITKEEYASFYKTISN-DWEDHLAVKHFSVEGQIEFTALLFV 334 Ent...
5_pfamImport              73 -------eAPKTRS-ETRTVWNWERVNEVKAIWTRSKDDIADEEYESFYHSLQKtDITDPLTWIHFQAEGEIEFKSILYV 144
XP_002185513             288 --------EPKMKT-VPETKEGYERVNNQKPIWLRPPREVEEDEYTDFYKSAFRaSYDDPMKWTHFVLEGQVECKALLYI 358 Pha...
EPB92434                 225 --------KGKKKT-EKRMVYGWHHVNVQKPIWMRDPKDITEDDHKEFYKSLTR-ESSNPLAWTHFKGEGEIEFRTLLYV 294 Muc...
CBZ12407                 278 --------EGGTQG-VAK-ERRWVLVNENRPIWTRPIGNVTEEEYHKFYKAFSG-DYRDPLYFSHFKVEGEVDFDSILFV 346 Lei...
XP_001566424             279 ----------GEEK-VPRMEKRWTLINENRPIWTRQIGNVTEEEYIKFYKAFSG-DYRDPLYFSHFKVEGEVDFDSILFI 346 Lei...
CDS42723                 294 --------KPKSKKtVEKTVWDWIQLNDLKPIWTKKPSEVAEESYKELFKVLSR-SSESPLAHIHFSAEGEVSFNAILFI 364 Ech...
EFX71215                 322 --------KPKTRK-IEKTTWDWELLNNAKPIWTRKPSEVEENEYEEFYKAITK-DTQGPLGHIHFVAEGEVTFKSLLYI 391 com...
EFA78289                 330 ksliddapKPAEKK--KIDVFDWEIVNDHKPLWVRSPKEITEEEYNEFYKTLSK-GTENPLAHSHFVTEGDTEFRSIIYI 406 Het...
XP_001617311             306 --------NKKTRT-VEKKVKKWKLMNEQKPIWLRPPKELTDEDYKKFFSVLSG-FNDEPLYHIHFFAEGEIEFKCLIYI 375 mal...
WGS:AAFB:cds.EHI_102270A 335 PQRAPF---DMFET--KKKPNn-IKLYVRRVFIMDDCRELIPEWLGFIKGVVDSEDLPLNVSREMLQQNKILKVIRKNLV 408 Ent...
5_pfamImport             145 PGQAPR---DLYTRfeNKKAD--IKLYVRKVLITDDFDDFLPRYLNFVAGVVDSDDLPINVSRETLQENKILRVIRKKLV 219
XP_002185513             359 PGMLPF---ELSKDmfDENARn-IRLYVKRVFINDKFEDLMPRWLKFVRGVVDSNDLPLNVSREILQKSKVLSIINKRLV 434 Pha...
EPB92434                 295 PPVVND---VFYQNvqKDQSNhpIKLFVKRVFISDEV-DLLPKWLSFLKGIVDADDMPLNVSRETLQKHRSLRIITRHLV 370 Muc...
CBZ12407                 347 PTTVDP---ASFSDdnAAPNTn-IKLYVRRVFITDEFRDLLPRYLNFVKGIVDSNDLPLNVSREVLQESRILRVIKKKLV 422 Lei...
XP_001566424             347 PSTVDP---ASFSDdkANPSTn-IKLYVRRVFITDEFRDLLPRYLNFVKGIVDSNDLPLNVSREVLQESRILRVIKKKLV 422 Lei...
CDS42723                 365 SPVPRP---DLFQSd-kLITDn-IKLYVRKVFITENVDEMLPRYLSFVYGIVDSDNLPLNVSREMLQQHKLLKLIKKKLV 439 Ech...
EFX71215                 392 PKAQPT---ESFNKy-gTRTDn-IKLYVRRVFITDDFQDIMPNYLNFVRGVVDSDDLPLNVSRETLQQHKLIKVIRKKLI 466 com...
EFA78289                 407 PNTPPA---NLFDp--EAIIDg-LKLFVRRVFITDSMKDLVPSWLRFLQGIIDSDDLPLNVSREILQQHKILKKIKDTLV 480 Het...
XP_001617311             376 PSRAPSindHLFT-----KQNs-IKLYVRRVLVADEFVEFLPRYMSFIKGVVDSDDLPLNVSREQLQQNKILKAVSKRIV 449 mal...
WGS:AAFB:cds.EHI_102270A 409 KKCLELFVEI-SENKED-----------------------------------------------FKKFYEAFGKNLKLGI 440 Ent...
5_pfamImport             220 RKVLEMLRKL-SEQEEGddddddeeddevadvstdadskteadtktdseeeaeeeeeedeanakYNKFWEEFGKNIKLGV 298
XP_002185513             435 RKSLDMIRDI-EQDEDEg---------------------------------------------qYVMFWNNFGKYLKVGV 468 Pha...
EPB92434                 371 KKALDMFTSL-SE-NDPk---------------------------------------------aFAKFLSQYGTILKYGA 403 Muc...
CBZ12407                 423 RKTLSMFADI-AA-QDEaiadgkqvenpa------------------------lsghthlkkpaYTKFWELYGKHLRLGV 476 Lei...
XP_001566424             423 RKALNMFANI-AA-QDVeiankdhaedpa------------------------psghthlkkptYAKFWDLFGKHLRLGA 476 Lei...
CDS42723                 440 RKVIEMLQKM-SDED-------------------------------------------------YEKFWKAYSVAVKLGV 469 Ech...
EFX71215                 467 RKTLDMIKKL-DKEG-------------------------------------------------QEKFWAEYSTNIKLGV 496 com...
EFA78289                 481 KKFIKLVQDL-SNNEDKt---------------------------------------------vYQNFYKKYGNNLKFGV 514 Het...
XP_001617311             450 RKILDTFRTLyTSGKKNkedlraqlaketdee------------------kkkeiqkkinepstYKLIYKEYRKYLKTGC 511 mal...
WGS:AAFB:cds.EHI_102270A 441 HEDST---NRDKIAELLRFYSSKSGE-DMTSFKDYIARMKENQKEIYFITGESKKAVETSPFVEGFVKKGIEVLYMTDPI 516 Ent...
5_pfamImport             299 MDDAS---NRGKLVKLLRFVTSQSDG-KWASLEQYVDRMKDWQDSIYYIAAENAEACEKSPFMEKMRAKGLEVLYFVDAL 374
XP_002185513             469 IEDDA---NRKEIAPLLRFFSSQSGE-EYTSLEKYVEAMPEGQKSIYYVTGDGRENASMSPVIEKLASRGYEVLFATEPL 544 Pha...
EPB92434                 404 IEDQP---YRKKITSLLRFATSSNTEaFSSSLDDYIDRAKADQKNIYFMTGSNIAEIEQSPFIESLLARGYEIIYFTDPI 480 Muc...
CBZ12407                 477 MLDSN---NRNRLTKLFRYKSSRSES-EYISLQTYVDRMKKGQKGIYYLSGDSVARIKKSPVLEDAVNHDVEVIFMTDAI 552 Lei...
XP_001566424             477 ITDSN---NRNRLMKLFRYKSSASET-EYISLQAYVDRMKKGQKGIYYLSGDSVDRIKKSPVLEDALNHGFEVIFMTDPI 552 Lei...
CDS42723                 470 LQDAP---NKARLTELLRFYTSKSED-KLTSFSNYISRMKEGQEHIFYVAGQNIDEVKTSLFVERIKRLGFEVIYFTEPM 545 Ech...
EFX71215                 497 IDDSA---NRSRLAKLLQFRSSANKG--FVTFSDYVERMKEKQESIYFIAGSSLDEVEKSPFVERLVKKGYEVLYLTEAV 571 com...
EFA78289                 515 IEETSnthNKNRLIKLLMFPSSKD---EFTTFENYVSRMKEGQEQIYFISGKSKETLKSSPLIEQALKRGYEVIYMVDPI 591 Het...
XP_001617311             512 YEDDI---NRSKIVKLLLFK-TMLHP-KSISLDTYVENMKPDQKFIYYASGDSYEYLSKIPQLQIFKKKNIDVVFLTESV 586 mal...
WGS:AAFB:cds.EHI_102270A 517 DEYAMQQLKEFDGKKLVCITKDGIKV--E-ETEEEKKEQEAKEKDNEELSKVVKE-ILG-DKIEKVVISNRLVNSPCALV 591 Ent...
5_pfamImport             375 DEYMVSHMSEFDGKKLVSITKEGIKFgdE-DESLTQKREQLYADKYVALTTALKT-LYG-DKISRVTMSQRVVDSPAVMV 451
XP_002185513             545 DEIMMESLRNYKDKDVVDAAKENLNLddS-QDEESKKKKEQLREEYKQVAEYLET-LLK-GKVQKVVISDQLTDSPAALV 621 Pha...
EPB92434                 481 DETFVENIPGYNRKQFVNIAKGDLTF-----DDDEQDVDQGLEAKFKPLTDWLFD-TLY-ESIEKAVISRRLTTSPFAIV 553 Muc...
CBZ12407                 553 DEYVVSQLTDFAGKKLINLAKEGVQF--EeSDARQRVADRKRKEKYDSFFTHLRV-LFGySEVRKVILTKRMTNEAFIVS 629 Lei...
XP_001566424             553 DEYAVSHLTDFAGNKLINLAKEGVAF--EeTDSRQRVVDKKRREKYNSLFTHLRG-IFGySEVRKVILTRRMTNEAFIVS 629 Lei...
CDS42723                 546 DEYVMQSLHEVMGKKTQNLAKAGLDLklD------KEKFEEQEKLFRPLTDWLKDkGLS-GKIKDAKISQRLESSPCALV 618 Ech...
EFX71215                 572 DEYCISALPEFEGKKFQNVAKEGVEL--D-EGEGAKAKLEALKTQFEPLTKWLTEtALK-EHILRAEIGQRLLKTPCALI 647 com...
EFA78289                 592 DEYLIPQITTYNNKKLTNLAREGVKF--E-DAVADEEQEKQVAEEYKPLTDFLQK-QLG-KKVEKVVISKILADSPCVLV 666 Het...
XP_001617311             587 DESCVQRVQEYDGKKFKSIQKGEITF--E-LTDDEKKKEEKVKKMYKALIDVISD-TLR-NQIFKVEISRRLVDAPCAVV 661 mal...
WGS:AAFB:cds.EHI_102270A 592 TGEYGWSANMERIMKAQALR---DNSMSTYMVS----KKTLEINPDHPIVQELRKRVHT-DNSD---KTVKDLVVLLFET 660 Ent...
5_pfamImport             452 TSQWGYSANMQRIMKAQTFAn-gEKNSPMYGTG----SAILELNPRHPIVSKLNGLMVS-DPEK---DETKDLAWLLYDT 522
XP_002185513             622 QGAYGMSPTMQRYMRAQSVAsggNGDLPGMN------QAVMEVNPNHPIVRGLDRMIKV-DKES---TELQDRALLMYDV 691 Pha...
EPB92434                 554 APKTGLSGHAQRVLDAQGVNh-kNPNMEYILESmrlqKKILEINPNHPVITTLLDYVEE----DnitEEMTNLIQLMYET 628 Muc...
CBZ12407                 630 SGENQITARLASIMRGQSMSlanQQMTA---------ERVLEVNYRHPLVDEMFKRFTV-DEND---EVATDIAWVLYDT 696 Lei...
XP_001566424             630 SGDNQITARLASIMRGQSMSladQKVTA---------ERVLEVNYRHPLVDEMFKRFTV-NEDD---EVATDIAWVLYDT 696 Lei...
CDS42723                 619 ADEYMVSGNFQKVILAQAYAtsdSATNSYYLNQ----KHTLEINPRHPLIKKLNELIQI-DPDD---EVAKENTLLLFDT 690 Ech...
EFX71215                 648 TSKFGWTGNMQRIIASQTHSktqDVQRDYYLTQ----KKTLEINPRHPLIKELLKRVEA-NPED---RISKGMAMMMFQT 719 com...
EFA78289                 667 TNQWGVTANMERIMKAQSFGnaqEDNYMAMMN-----KKIMEINPDHTLIKQLLSRLNEfGADD---EVAKVSAQVLFET 738 Het...
XP_001617311             662 STEWGLSGQMEKLMKINVN----NADQIKAMSG----QKILEINPDHPIMIDLLKRSVS-NPKD---SQLTESIKIIYQS 729 mal...
WGS:AAFB:cds.EHI_102270A 661 ALLSSGFSLDEPAAFAGRIYRMVKLGLSLdd-kEEEQ----------PNEAVPAVE 705 Entamoeba histolytica HM-1:...
5_pfamImport             523 ALVNSGFDMADTNQFSTRIHRIMKSSMGI----DSLElepeievpeeEEEVDEEEE 574
XP_002185513             692 AAMTSGYEVGDMKSFAARVMGLMDTGVGGisdaEIISesptpteteePKMEAKMED 747 Phaeodactylum tricornutum C...
EPB92434                 629 TAIRSGFPLKDMTQFAGRVEGLIRKAVGV-----SILeeakvkvkkaNEKTEEERK 679 Mucor circinelloides 1006PhL
CBZ12407                 697 ANLQAEFPVADVAAYSKRINRLLRSSVDLsaddSLLPpddaeytvsdTEAEEEEEQ 752 Leishmania major strain Fri...
XP_001566424             697 ANLQAEFPVADVAAYAKRINRLLRSSVDLnaddSLLPpdddeytvfdTETEEEKPT 752 Leishmania braziliensis MHO...
CDS42723                 691 AVLRSGYIMQDLSGFAERIERELRKNLDVdp-dEQVEpdesipsetdSANVTEMES 745 Echinococcus multilocularis
EFX71215                 720 ATLRSGYMLQDPSQFAEHIDAMLKQSLGIg--dEVVEedeeietvpeAENAEEEAE 773 common water flea
EFA78289                 739 SSLSSGYIVENPSNFANWIYKMMEVsg-----eKIKEasfkveeeeqQQAQEPEVE 789 Heterostelium album PN500
XP_001617311             730 AKLASGFDLEDTADLAQIVYDHINQKLGVdnnlKIDDldpaifetkkMEQEDSPDG 785 malaria parasite P. vivax
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap