Conserved Protein Domain Family
Glyco_hydro_19

?
pfam00182: Glyco_hydro_19 
Chitinase class I
Statistics
?
PSSM-Id: 425508
Aligned: 6 rows
Threshold Bit Score: 411.937
Created: 26-Apr-2021
Updated: 29-Sep-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P25765        84 IVSRSLFDQMLLHRNDAACPASNFYTYDAFVAAASAFPGFAAAgGDADTNKREVAAFLAQTSHETTGGWATAPDGPYAWG 163 Japanese rice
Q05537         8 LISKNLFERILVHRNDRACGAKGFYTYEAFITATKTFAAFGTT-GDTNTRNKEIAAFLAQTSHETTGGWATAPDGPYSWG 86  tomato
P05315        82 aISNSMFDQMLKHRNENSCQGKNFYSYNAFINAARSFPGFGTS-GDINARKREIAAFFAQTSHETTGGWASAPDGPYAWG 160 potato
1_pfamImport   1 IISRSQFDDMLKHRNDNACPARGFYTYDAFINAAKSFPGFGTT-GDTATRKKEIAAFFGQTSHETTGGWATAPDGPYSWG 79 
Q05539        30 IVTRELFEQMLSFRNNDACPAKGFYTYDAFIAAANSFPGFGTA-GDDTARKKEIAAFFGQTSHETNGG----SAGTFTGG 104 tomato
Q05540        22 IVTSDLFNEMLKNRNDDRCPAKGFYTYDAFIAAANSFPGFGTT-GDDTARKKEIAAFFGQTSHETTGGS-LSADGPFAGG 99  tomato
P25765       164 YCFKEENGgaAGPDYCQQSAQWPCAAGKKYYGRGPIQLSYNFNYGPAGQ--AIGADLLGDPDLVASDATVSFDTAFWFWM 241 Japanese rice
Q05537        87 YCYNREQG--SPGDYCASSQQWPCAPGKKYFGRGPIQISYNYNYGAAGS--AIGVNLLNNPDLVANDAVVSFKTALWFWM 162 tomato
P05315       161 YCFLRERG--NPGDYCPPSSQWPCAPGRKYFGRGPIQISHNYNYGPCGR--AIGVDLLNNPDLVATDPVISFKTALWFWM 236 potato
1_pfamImport  80 YCFKQEQN--PSSNYCSPSAEWPCASGKSYYGRGPMQLSWNYNYGQCGR--AIGSDLLNNPDLVSNDPVIAFKAAIWFWM 155
Q05539       105 YCFVKQ-----------------IEQSDRYYGRGPIQLTHQSNYERAGQgiGVGQELVNNPDLVATDPIISFKTAIWFWM 167 tomato
Q05540       100 YCFVREG----------------NQMGSGFYGRGPIQLTGQSNYDLAGQ--AIGQDLVNNPDLVATDATVSFKTAIWFWM 161 tomato
P25765       242 TPQSPKPSCHAVATGQWTPSADDQAAGRVPGYGVITNIINGGLECGHGED-DRVADRIGFYKRYCDILGVSYDANLDC 318 Japanese rice
Q05537       163 TAQQPKPSAHDVITGRWSPSVADSAPGRVPGFGVITNIINGGMECNSGSN-ALMDNRIGFYRRYCQILGVDPGNNLDC 239 tomato
P05315       237 TPQSPKPSCHDVIIGRWNPSSADRAANRLPGFGVITNIINGGLECGRGTD-NRVQDRIGFYRRYCSILGVTPGDNLDC 313 potato
1_pfamImport 156 TPQSPKPSCHAVIVGQWQPSDADRAAGRVPGYGVITNIINGGLECGRGQDaTRVADRIGFYQRYCNILGVNPGGNLDC 233
Q05539       168 TEQDNKPSCHNVIIGQWTPSPKDTAANRVPGYGVITNIINGQFECGMGPN-TAAESRIGFYRRYCGMLNVPTGENLDC 244 tomato
Q05540       162 TAQGNKPSCHDVITGQWTPSAADASANRQPGYGVITNIINGGIECGKGQN-PQVEDRIGFYRRYCTILNVAPGDNLDC 238 tomato
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap