1XP8


Conserved Protein Domain Family
RecA

?
pfam00154: RecA 
Click on image for an interactive view with Cn3D
recA bacterial DNA recombination protein
RecA is a DNA-dependent ATPase and functions in DNA repair systems. RecA protein catalyzes an ATP-dependent DNA strand-exchange reaction that is the central step in the repair of dsDNA breaks by homologous recombination.
Statistics
?
PSSM-Id: 425488
Aligned: 14 rows
Threshold Bit Score: 463.024
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1XP8_A  23 KAIETAMSQIEKAFGKGSIMKLgAES-KLDVQVVSTGSLSLDLALGVGGIPRGRITEIYGPESGGKTTLALAIVAQAQKA 101 Deinococcus radiodurans
O67905  10 KALEVALSNIEKRFGKGAVMPL-KSVeKVQVETIPTGSLALDIATGVGGIPKGRITEIFGVESSGKTTLALHVIAEAQKR 88  Aquifex aeolicus VF5
P29226  15 KIIKSTIEEIEKKFGNESIMLL-GQKeKCDVDVFSSGSYAINSALGIGGFPKGRIIEIFGPESSGKTTIALHTIAEIQKK 93  Mycoplasmopsis pulmon...
A9NGM3   8 QALELALKQIEKQFGKGSIMKLgDGA-DHSIEAIPSGSIALDIALGIGGYPRGRIIEVYGPESSGKTTLTLHAMASAQKQ 86  Acholeplasma laidlawi...
P16971   6 AALDMALKQIEKQFGKGSIMKLgEKT-DTRISTVPSGSLALDTALGIGGYPRGRIIEVYGPESSGKTTVALHAIAEVQQQ 84  Bacillus subtilis sub...
P0A452  21 KALNDALKLIEKDFGKGSIMRL-GERaEQKVQVMSSGSLALDIALGSGGYPKGRIIEIYGPESSGKTTVALHAVAQAQKE 99  Streptococcus pneumon...
P42442  20 KALDAALALIEKDFGKGAVMRLgDEN-RPPIQTISSGNTAIDIALGIGGFPRGRIVEVYGPESSGKTTVALHAIAQAQKA 98  Corynebacterium gluta...
P42445   9 KAISLAIKQIDKVFGKGALVRLgDKQ-VEKIDSISTGSLGLDLALGIGGVPKGRIIEIYGPESSGKTTLSLHIIAECQKN 87  Helicobacter pylori 2...
B7J7A9   7 KALSAALSQIDKQFGKGAVMRLgDHNaIKDIEVYSTGSLGLDLALGVGGLPRGRVVEIYGPESSGKTTLTLHAIASCQAA 86  Acidithiobacillus fer...
P33156  18 KALEAALSQIERSFGKGSIMKLgSNEnVVEVETVSTGSLSLDIALGIGGLPKGRIIEIYGPESSGKTTLALQTIAEAQKK 97  Agrobacterium fabrum ...
1XP8_A 102 GGTCAFIDAEHALDPVYARALGVNTDELLVSQPDNGEQALEIMELLVRSGAIDVVVVDSVAALTPRAEIEGDMGDSLPGL 181 Deinococcus radiodurans
O67905  89 GGVAVFIDAEHALDPKYAKKLGVDVENLYISQPDYGEQALEIAESLINSGAVDVIVVDSVAALVPKDELEGEMGEAQVGK 168 Aquifex aeolicus VF5
P29226  94 NGFAAFIDVEHSIDPVYAKNLGIDIDNLLISQPDSGEQALEIVDILAKSGSIDLIVVDSVAALVPEAELNGEMKDQSIGL 173 Mycoplasmopsis pulmon...
A9NGM3  87 GGTVAFIDAEHALDPNYAKALGVDIDNLVLSQPDTGEQALDIAEALIKSGSIDMIVIDSVAALVPEAEIAGDMSANHVGL 166 Acholeplasma laidlawi...
P16971  85 GGQAAFIDAEHALDPVYAQKLGVNIEELLLSQPDTGEQALEIAEALVRSGAVDIVVVDSVAALVPKAEIEGDMGDSHVGL 164 Bacillus subtilis sub...
P0A452 100 GGIAAFIDAEHALDPAYAAALGVNIDELLLSQPDSGEQGLEIAGKLIDSGAVDLVVVDSVAALVPRAEIDGDIGDSHVGL 179 Streptococcus pneumon...
P42442  99 GGIAAFIDAEHALDPDYARKLGVDTDALLVSQPDTGEQALEIADMLVRSGAIDIIVIDSVAALTPKAEIEGEMGDSHVGL 178 Corynebacterium gluta...
P42445  88 GGVCAFIDAEHALDVHYAKRLGVDTENLLVSQPDTGEQALEILETITRSGGIDLVVVDSVAALTPKAEIDGDMGDQHVGL 167 Helicobacter pylori 2...
B7J7A9  87 GGTAAFIDAEHALDPGYAHKLGVDLENLLISQPDTGEQALEIADMLVRSGAVDLIVIDSVAALTPKAEIEGDMGDSHVGL 166 Acidithiobacillus fer...
P33156  98 GGICAFVDAEHALDPVYARKLGVDLQSLLISQPDTGEQALEITDTLVRSGAVDVLVIDSVAALTPRAEIEGEMGDSLPGL 177 Agrobacterium fabrum ...
1XP8_A 182 QARLMSQALRKLTAILSKTGTAAIFINQVREKIGVMYG-NPETTTGGRALKFYASVRLDVRKIGQPTKVGn---DAVANT 257 Deinococcus radiodurans
O67905 169 QARLMSQALRKLKGAVHKSNTALIFINQIREKIGVMFG-NPETTPGGRALKFFSDMRLEVRRLGDVKEGG----EKKGYR 243 Aquifex aeolicus VF5
P29226 174 QARLMSKALRKITGSLSKNKTSVIFINQVREKIGVVFG-NPETTPGGRALKFYASIRLDVRKSTNIMLNNdi----sGNQ 248 Mycoplasmopsis pulmon...
A9NGM3 167 QARMMSQAMRKMSGVISKSNVVAIFINQIREKVGVMFG-NPETTPGGRALKFFSSVRLEIRRAEAIKQGS----EMIGIK 241 Acholeplasma laidlawi...
P16971 165 QARLMSQALRKLSGAINKSKTIAIFINQIREKVGVMFG-NPETTPGGRALKFYSSVRLEVRRAEQLKQGN----DVMGNK 239 Bacillus subtilis sub...
P0A452 180 QARMMSQAMRKLGASINKTKTIAIFINQLREKVGVMFG-NPETTPGGRALKFYASVRLDVRGNTQIKGTGdqkeTNVGKE 258 Streptococcus pneumon...
P42442 179 QARLMSQALRKMTGALYNSGTTAIFINQLREKIGVMFG-SPETTTGGKALKFYASVRCDIRRIQTLKDGQ----DAIGNR 253 Corynebacterium gluta...
P42445 168 QARLMSHALRKITGVLHKMNTTLIFINQIRMKIGMMGYgSPETTTGGNALKFYASVRIDIRRIASLKQNE----QHIGNR 243 Helicobacter pylori 2...
B7J7A9 167 QARLMSQALRKLTANISRTNTLVIFINQIRMKIGVMYG-SPETTTGGNALKFYASVRLDIRRIGAIKKSD----EVVGND 241 Acidithiobacillus fer...
P33156 178 QARLMSQALRKLTASISKSKCMVIFINQIRMKIGVMFG-SPETTTGGNALKFYASVRLDIRRIGAVKERE----EVVGNQ 252 Agrobacterium fabrum ...
1XP8_A 258 VKIKTVKNKVAAPFKEVELALVYGKGF 284 Deinococcus radiodurans
O67905 244 VKVRVVKNKLAPPFQEAEFDIIYGEGI 270 Aquifex aeolicus VF5
P29226 249 IRVKVVKNKLAPPFKIAETEIIFSKGI 275 Mycoplasmopsis pulmonis UAB CTIP
A9NGM3 242 SNVKVVKSKVAPPLKTASIDIMYGTGI 268 Acholeplasma laidlawii PG-8A
P16971 240 TKIKVVKNKVAPPFRTAEVDIMYGEGI 266 Bacillus subtilis subsp. subtilis str. 168
P0A452 259 TKIKVVKNKVAPPFKEAVVEIMYGEGI 285 Streptococcus pneumoniae R6
P42442 254 TRLKVVKNKVSPPFKIAEFDIMYGEGI 280 Corynebacterium glutamicum ATCC 13032
P42445 244 AKAKVVKNKVAPPFREAEFDIMFGEGI 270 Helicobacter pylori 26695
B7J7A9 242 TRVKVVKNKVAPPFREAEFAIYYGEGI 268 Acidithiobacillus ferrooxidans ATCC 23270
P33156 253 TRVKVVKNKMAPPFKQVEFDIMYGEGV 279 Agrobacterium fabrum str. C58
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap