7DRT


Conserved Protein Domain Family
wnt

?
pfam00110: wnt 
Click on image for an interactive view with Cn3D
wnt family
Wnt genes have been identified in vertebrates and invertebrates but not in plants, unicellular eukaryotes or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about Wnt protein structure, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families.
Statistics
?
PSSM-Id: 459677
Aligned: 174 rows
Threshold Bit Score: 261.332
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
7DRT_A         44 SIPGLVPKQLRFCRNYVEIMPSVAEGIKIGIQECQHQFRGRRWNCTTVHDSl--AIFGPVLDKATRESAFVHAIASAGVA 121
XP_007235655   46 TLPGLTRKQLDVCMRNPDVTASAIQGIQIAIHECQHQFRGHRWNCSSLETRnkiPYENVIFSKGFRESAFAYAIAAAGVV 125
21_pfamImport   1 TLPGLTRRQLEVCMRNPDVTASAIQGIQIAIHECQHQFRGHRWNCSSLETRnkiPYDSIVFKRGFRESAFAYAIAAAGVV 80 
11_pfamImport   1 --AGLNKPQQEICRKHPELTLAALQGLAQAVKECQFQFRWHRWNCSSLSTKnnnPHTSLILSRGYRESGFAHAITAAGVA 78 
XP_396944      58 GIPGMTKEQRELCHRNPDVTVAAIKGLQMAISECQHQFMWHRWNCSSLTPSsrtQQSSVLLQRGYRETAFAFAISAAGVA 137
XP_002066911   58 SVPGLTKDQVELCYKASDVTAAALEGLDMAIRECQIQFQWHRWNCSSLSTKsrnPHASNLLKKGYRESAFAFAISAAGVA 137
Q17NQ1         10 TVPGLTREQLELCYRASDVTAAAIEGLELGVRECQHQFQWHRWNCSSLSTKsrnPHTSSMLKRGYRESAFAYAVAAAGVT 89  yellow fever m...
EFX86388       53 NFPGLSKKQLELCFRYPDVMSAAIGGLQLAVNECQFQFQKHRWNCSALDRKnrnPHSSNFLQKGYRETAFAYAVSSAGVA 132
XP_024141673   54 TLPGLTRRQLEVCMRNPDVTASAIQGIQIAIYECQHQFKGHRWNCSSLETRnkiPYDSIVFKRGFRESAFAYAIAAAGVV 133 Indian medaka
XP_029873903  250 TLPGLTRRQLEVCVRHPDVTASAIQGIQIAIHECQHQFRDQRWNCSSLETKnkiPYESIIFSRGFRESAFAYAIAAAGVV 329 Aquila chrysae...
7DRT_A        122 FAVTRSCAEGTAAICGCSSR---------H-QG--------------------------------------SPGKg---- 149
XP_007235655  126 HAVSNACSMGKLKACGCDEK---------R-RGdeeafrvklnrlqleainr-gkgmvhgvmehfpseplgPQDSw---- 190
21_pfamImport  81 HAVANACSMGKLKACSCDEK---------R-RGdeeafriklhrlql----------eaihrgkgmvhgvmEHFPtdlpg 140
11_pfamImport  79 HAVARACAQGNVLECGCDAH---------H-KIgt-----------------------------------pGGGTw---- 109
XP_396944     138 HSVARACSMGRLLSCGCDPS---------S-YKgkp---------------------------------psKARGtq--- 171
XP_002066911  138 HSVARACSQGRLMSCGCDPTinrktlnknL-RQsldkekklflqy---------------letnqiltpeeEKKYerski 201
Q17NQ1         90 HSVARACAQGRLISCGCDPS---------V-NRkgmtkslreslekek---------lrfldainensilvDDSLkklkt 150 yellow fever m...
EFX86388      133 HSVSKACGQGKLESCGCDPK---------S-QRgngg-------------------------------fgsSSTLad--- 168
XP_024141673  134 HAVANACSMGKLKACGCDEK---------R-RGdeeafrlkverlqleaiqrrrgmshgvmehfpaelsghHQDTw---- 199 Indian medaka
XP_029873903  330 HAVSNACALGKLQACGCDQK---------RrGDeeafrrklhrlqle-----------amnrgkgmvhgvhMEHMpaetp 389 Aquila chrysae...
7DRT_A        150 -----wK-WGG----CSEDIEFGGMVSREFADAREN--RPd-ARSAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKT 216
XP_007235655  191 ------E-WGG----CSPNVEFGERFSKEFLDSRET--YRd-MHARMRLHNNRVGRQIVVDHMRRKCKCHGTSGSCQLKT 256
21_pfamImport 141 -pqesdDcWEGsgkkCGANTYFGPPWKKSFLIMRIKksGGmnQPG-LFLHVCVL--QVVLDHMRRKCKCHGTSGSCQLKT 216
11_pfamImport 110 ------K-WGG----CSHNLQFGLDFSKKFLDVRES--TNgdIQSRVSLHNNEAGRLAVARNMEIRCKCHGVSGSCELKT 176
XP_396944     172 -----wK-WGG----CSHNLDYGMEFSRQFLDTRER---AgdIQSTVNLHNNQAGRLAVASNMQVRCKCHGMSGSCELKT 238
XP_002066911  202 --asrwK-WGG----CSHNMDFGVEYSKLFLDCREK---AgdIQSKINLHNNHAGRMAVSNNMEFRCKCHGMSGSCQLKT 271
Q17NQ1        151 kqasrwK-WGG----CSHNMAFGVEFSELFLDTREK---GgdIQSQINLHNNHAGRRAVSNNMQVRCKCHGMSGSCQLKT 222 yellow fever m...
EFX86388      169 -----wR-WSG----CSHNMDFGVKFSRFLLDSRQR---GqdIHSRIHLHNSHVGRTVVGANSEIRCKCHGMSGSCEMKT 235
XP_024141673  200 ------E-WGG----CSPDVEFGEKFSRDFLDARET--YRd-IHARMRLHNNRVGRQVVLDHMRRKCKCHGTSGSCQLKT 265 Indian medaka
XP_029873903  390 glqdswE-WGG----CSPDVDYGEKFSKDFLDSRET---YrdIHSRMRLHNNRVGRQVVMDNMRRKCKCHGTSGSCQLKT 461 Aquila chrysae...
7DRT_A        217 CWWSQPDFRAIGDFLKDKYDSaSEmvV----------------------------EKHRESRGwv-----------eTL- 256
XP_007235655  257 CWQVTPEFRVVGSLLKERFNLaTL--Vk---------------------------PHNRNTGQ--------------VE- 292
21_pfamImport 217 CWQVTPEFRLVGSILKERFHIaTL--I----------------------------KAHNRNTG--------------QLd 252
11_pfamImport 177 CWRAAPEFRTVGAILKERFREsLM--V-----------------------------EESNQGG--------------SHl 211
XP_396944     239 CWKVAPDFRIVGKTLKDRFRNaVL--Vaqsnlg----------------svtpltRVRGSRRR----------------- 283
XP_002066911  272 CWKSAPDFHVVGKVIKHQFRKaIL--Vdqsnlgngep---------vvvlkrtrnKKSNGDGGdvvdasgsilelggGHh 340
Q17NQ1        223 CWKSAPDFRVVGKVLKQQYRRaVL--VdqsnlgngppmivyhkpkkrkhvnnvrpPRRTKDKGqqq--------qqrHL- 291 yellow fever m...
EFX86388      236 CWKAVPEFRRVGTVLKERFNQaVL--Vd--------------------------qSQLGNEAG----------------- 270
XP_024141673  266 CWQVTPEFRKVGSILKERFHVaTL--I----------------------------------------------------- 290 Indian medaka
XP_029873903  462 CWQVTPEFRLVGSLLKDRFYGaTL--I----------------------------RPHNRNAG--------------QL- 496 Aquila chrysae...
7DRT_A        257 -RP--RYTYF-----------------------------------KV-----------------------------PTER 269
XP_007235655  293 -QA--HPSHR-----------------------------------RR-----------------------------ANVH 305
21_pfamImport 253 hSH--YNSHNnt-------------------------------hrRR-----------------------------PSIN 270
11_pfamImport 212 sIR--EKKRRr----------------------------------GR-----------------------------KRPE 226
XP_396944     284 -RPdrQRQRKhrggsg-----------------------gngrkrRP-----------------------------RDLA 310
XP_002066911  341 dTH--RRHEElgverdgtgggrngdggglgggsrqsnsdknaarmAR-----------------------------KLET 389
Q17NQ1        292 -IP---ISRA-----------------------------------NR-----------------------------KMEN 303 yellow fever m...
EFX86388      271 -SSskGRQFA-----------------------------------RR-----------------------------IRDT 285
XP_024141673  291 -KA--HNRNT-----------------------------------GQldhshnnnhnnhhhhhqhnhhhhhshrrrPGIN 332 Indian medaka
XP_029873903  497 -EP--GHARHr----------------------------------RR-----------------------------AGIS 510 Aquila chrysae...
7DRT_A        270 D-LVYYEASPNFCEPNPETGSFGTRDRTCNVSSHGIDGCDLLCCGRGHNARAERRREKCRCVFHWCCYVSCQECTRVYDV 348
XP_007235655  306 D-LIYFEKSPDFCERDPGSDSDGTHGRICNKTSQDMDNCRSLCCGRGHNIQQQTRSERCNCKFHWCCYVVCEECRITEWV 384
21_pfamImport 271 E-LVYFEKSPDFCERDLGSDSAGTQGRICNKTSPGMDNCESLCCGRGHNILQQTRRERCNCKFHWCCYVVCEECRITEWV 349
11_pfamImport 227 N-IFYYEKSPSFCEKDVNLEVHGTVGRVCNRSSRGVDSCSSLCCGRGYNIIRRRRTDRCNCKFHWCCYVTCKNCTVDEWI 305
XP_396944     311 KqLFYYQKSPNFCERDPSADIPGTAGRRCNKTSSGGDGCGNLCCGRGYNVVRQRRVERCKCKFHWCCIVQCQNCTVEEWI 390
XP_002066911  390 S-LFYYQRSPNFCERDLGADIQGTVGRKCNRNTTTSDGCASLCCGRGHNQIKERRAERCRCKFQWCCNVECEECHVEEWI 468
Q17NQ1        304 A-LFYYQRSPNFCERDQVSDIPGTVGRRCNRTSVGSDGCASMCCGRGYNLIREKRVDRCNCKFHWCCYVECDDCEIEEWI 382 yellow fever m...
EFX86388      286 D-LLFYERSPNFCEERPDVDYPGITGRRCNKTGDELDNCQSLCCGRGYNVVRQKRTERCHCRFHWCCSVVCNNCTVEQWV 364
XP_024141673  333 E-LVFFEKSPDFCERDLSSDSAGTQGRICNKTSHGMDNCESLCCGRGHNILQQTRSERCNCKFHWCCYVVCEECRITEWV 411 Indian medaka
XP_029873903  511 E-LVYFEKSPDFCEREPALDSLGTQGRLCNKTSPGMDNCESLCCGRGHNILRQTRSERCNCKFHWCCFVACEECRITEWV 589 Aquila chrysae...
7DRT_A        349 HTCK 352
XP_007235655  385 SVCK 388
21_pfamImport 350 SVCK 353
11_pfamImport 306 TVCK 309
XP_396944     391 TVCK 394
XP_002066911  469 SVCN 472
Q17NQ1        383 SVCN 386 yellow fever mosquito
EFX86388      365 TVCK 368
XP_024141673  412 SVCK 415 Indian medaka
XP_029873903  590 SVCK 593 Aquila chrysaetos chrysaetos
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap