Conserved Protein Domain Family
7tm_3

?
pfam00003: 7tm_3 
7 transmembrane sweet-taste receptor of 3 GCPR
This is a domain of seven transmembrane regions that forms the C-terminus of some subclass 3 G-coupled-protein receptors. It is often associated with a downstream cysteine-rich linker domain, NCD3G pfam07562, which is the human sweet-taste receptor, and the N-terminal domain, ANF_receptor pfam01094. The seven TM regions assemble in such a way as to produce a docking pocket into which such molecules as cyclamate and lactisole have been found to bind and consequently confer the taste of sweetness.
Statistics
?
PSSM-Id: 459626
Aligned: 616 rows
Threshold Bit Score: 57.67
Created: 28-Mar-2022
Updated: 17-Oct-2022
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
H2L0Q3        442 MTVSNEFYYPT------ILFAV-LGIAACV---FI-Y-LFTQKHH----ERLIIFQSQP-EC-----------NNILLIG 493  Caenorhabditi...
XP_028912976    8 EPLGMVLVSLA------LCFSL-LTALVLG---VF-I-HHRETSI----VKANNHSLSY-TL-----------LTALLLR 59  
EDO42855      442 MSFGSAAGVLI------FTFAL-LGILITS---CA-A-VVFWRLR----QTPIVSTSGR-WM-----------LSAFFVT 493 
Q0IHS7       1287 AYVIEDNKQLIlegqhhVSLSTvGAEALSFpqkQEqPeMVLLKFTrsenNAALVTPSPE-QL-----------SNLIKTS 1354 tropical claw...
Q54K11       1143 S-KTKIAKIII------GISAI-IVSIGVL---IT-A-ILTFIYR----KRKIMRYSNP-VF-----------LLIILVG 1193 Dictyostelium...
XP_004359342  783 D-ESSAVKITT------GILSG-VLITISI---VF-L-IITIVFR----KKRVIRYSNP-LF-----------LVITLVG 833 
Q54F54        690 K-VTSFVKFLV------GTLAA-ILLIILI---IS-G-FISLKYR----KKRVIRYSNP-LF-----------LCIILVG 740  Dictyostelium...
EGG23780      733 T-VSDLNKIIV------TFLVV-VIGLLTL---FC-F-GIVIVYW----SHPIIRFSNQ-IF-----------LCVILFG 783 
EFA77405      717 D-ISHTSIVAF------SVLTA-VLMAITL---VF-G-IMILVYW----KNIMIQHSNP-YF-----------LLTVIVG 767 
XP_007257508  291 lpynlnsmdidtkirelankiinssakvvllilkeelvrklfdemiqqniSRTWIASDSwSMsqetaqmdginQ----VG 366  Mexican tetra
H2L0Q3        494 CSLCLFSLFL--IGLPsddisiseslFP--LLCHA-----------------------------RVTILLFGFT----FA 536  Caenorhabditi...
XP_028912976   60 FLSSLTFVGH--PSLA----------TCl-LQQMN-----------------------------FRVIFSVAIS----TV 93  
EDO42855      494 LQLTFLFGIIf-VFAK----------PTt-ASCII-----------------------------IESIHELL-T----ML 527 
Q0IHS7       1355 --LHYPESFNhpFQQK----------SL----CL--------------------------------------------VP 1374 tropical claw...
Q54K11       1194 CVCGLVS-TF--V-SF----------STtsATCSI-----------------------------RMVLIPLFFF----II 1226 Dictyostelium...
XP_004359342  834 CILTMVSNLS--Q-LF----------YAsdFLCKF-----------------------------RMIFLPIPVF----VV 867 
Q54F54        741 CIIFLIT-IP--V-LF----------GStsATCKI-----------------------------RFPIIVIGSC----LV 773  Dictyostelium...
EGG23780      784 CCVLLAS-LI--T-SF----------IVspISCRL-----------------------------RSILLPMGLE----IP 816 
EFA77405      768 LLFIAAS-NF--L-LF----------GTstFSCIG-----------------------------KLVAVPIGVI----LC 800 
XP_007257508  367 NILGFSF---------------------------ItgpnpgfeeylqdlsippgaenkfieqykQM-------GaskdYL 412  Mexican tetra
H2L0Q3        537 YGSMFAK--VW-IVHR-MGATENQqlasrqkdeeentpwegirtlistmvgrqalMRKSSgqaygallekrntvlnqpis 612  Caenorhabditi...
XP_028912976   94 LAKTVTV--IL-AFKA-TGQGSRMrtwl------------------------gskASSSI-------------------- 125 
EDO42855      528 YSGFLFA--KT-RAANnILRRAVSpl---------------------------kdMPSDL-------------------- 557 
Q0IHS7       1375 VTLVLSN--SS-QAE----------------------------------------------------------------- 1386 tropical claw...
Q54K11       1227 TSAIFIK--QY-RVYC-LIRgveelhd-------------------------------------------------msie 1253 Dictyostelium...
XP_004359342  868 ATSVFVK--QF-SMWR-LVEgvqylre-------------------------------------------------tivt 894 
Q54F54        774 TSSVFIK--QF-RIWR-LIKdiqllre-------------------------------------------------tnve 800  Dictyostelium...
EGG23780      817 VAALVVK--QY-RLWK-IRKvlsfqlk-------------------------------------------------samg 843 
EFA77405      801 VNPVIIK--EW-RIWK-TRKdsyfeqk-------------------------------------------------snle 827 
XP_007257508  413 TTTVNIRtaYGeRMA----------------------------------------------------------------- 427  Mexican tetra
H2L0Q3        613 ssKFYViVAALTAVDVF-V---CFVWVLi--D-PLHLTE--------QKFPLftpadseedemiMPVLQQC-----QSNq 672  Caenorhabditi...
XP_028912976  126 --ICIC-SLIQVAICTV-W---LGISPR---FpDVDVTS--------EAGVIi-----------VQCNEGSp----TAF- 171 
EDO42855      558 --TGLIiLGVSIAIELV-L---IVI------RqSMAPSR--------SYFWNqe---------dNSRLLEC-----QQHf 603 
Q0IHS7       1387 -------------VDVI-V------DLRhkaRsPEALEThgsftwlgQTE------------------------------ 1416 tropical claw...
Q54K11       1254 nsYLLKlQSFILIIPAI-L---IAVSVIa--T-RMHRKYn-------FDLQK------------ETIQAYC------YSk 1301 Dictyostelium...
XP_004359342  895 nkMLLKlGALLMIMPVV-L---VICTFIf--T-PVYDYYd-------YDFDT------------LNVRHYC------KSp 942 
Q54F54        801 nkYLLKfISILMVIPII-I---VICSFFi--F-PTHEKYt-------FNQRD------------ITITHYC------SDg 848  Dictyostelium...
EGG23780      844 nrYFITyTAAYLVIPTI-V---VVVACTf--K-PLTPAIs-------FDTRD------------LTYSHIC------LGd 891 
EFA77405      828 tfFLFKwLIILSIIPII-L---LIVNVAv--S-NSKPMYv-------YDIDK------------REVSHVC------SNp 875 
XP_007257508  428 ------------VLSIAhAlkkLLK---------------------------------------------CnetacAGDt 450  Mexican tetra
H2L0Q3        673 -QEVWiGIIMG--FKCLLLVFGTFLSYETRNLKl--RFINDSRFVGLAIYNVAVMTLVTAPvVTllI--H-G---KvdaN 741  Caenorhabditi...
XP_028912976  172 -YCIL-GYMGL--LALVSLTVAFLARKLPDSFS---EAKFITFSMLVYCRIWVSFLPIYLS-TK--GkaMvAv--E---V 236 
EDO42855      604 -NVAR---IMAvaVPMTILVTTTFLAFRERNNT---DAFNEPKFLSFSTIALCILLSAFIP-TY-------Ry--V---V 663 
Q0IHS7       1417 -------------YKL-----------QLRSHEvftLQLK-ACFLHTGIYNLG------TPrVF---------------- 1449 tropical claw...
Q54K11       1302 nFYIIfICLAL--YEFSILLYGCWIVIKCRQYRsfpGSFNEFFYIGVLIYVLTVILVVSIP-IGf------AllnSaltD 1372 Dictyostelium...
XP_004359342  943 dYYIIfIIMLV--YMSIELLFGCYLVVVCRRFRnvpGTFNEAVYIGILLYNYVIILAVSVP-LGf------AyngDptaE 1013
Q54F54        849 sYLAYvIIFLV--YQMAILLFGCYLVIVCRKFRsipGTFNEATYIGILIYNYTVVLIVAIP-LAy------VfnkNplaN 919  Dictyostelium...
EGG23780      892 kAYLYvIVFLI--YALIFLFITCVLVFKTRPYRsspGSFSEPTYLGILTYNYLIILLLLLP-LRf------SfptKpnaQ 962 
EFA77405      876 eGWVYiVITLV--YLMILLMICCAYVYMGRRYLsspGSFNEPTYIGILIYNYIILIIVFIS-LRf------SfpnNynaQ 946 
XP_007257508  451 n----------------------fpPWMLlkelknirftledqtfyydklgsfnsgydlinwernmsngqrqfdvighys 508  Mexican tetra
H2L0Q3        742 fAFIS----LTVLICTYISVGLIYGP---K 764  Caenorhabditis elegans
XP_028912976  237 -FSIL----SSSTGILGFGPK--VYV---I 256 
EDO42855      664 gISRIlvvvFTAFATAFSCMGCLFIP---K 690 
Q0IHS7       1450 ----------AKLANQLTLFEANQQSsmpA 1469 tropical clawed frog
Q54K11       1373 fLLYS----IPILVLIVAIIGLLFAP---K 1395 Dictyostelium discoideum
XP_004359342 1014 lLIRS----AALELFVTTTITLIFLP---K 1036
Q54F54        920 fLIFS----ISIIVFVLSTIILLFIP---K 942  Dictyostelium discoideum
EGG23780      963 fLIVA----VASLIFVLVTLGLLFVP---K 985 
EFA77405      947 yITTA----SVDSAFILCTLLLLFCP---K 969 
XP_007257508  509 netiqinpgkpldwgntnntipvstcskac 538  Mexican tetra
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap