2Q0O,2KRF,1ZLK,1YIO,1FSE,1X3U,1P4W,1A04,1L3L


Conserved Protein Domain Family
HTH_LUXR

?
smart00421: HTH_LUXR 
Click on image for an interactive view with Cn3D
helix_turn_helix, Lux Regulon
lux regulon (activates the bioluminescence operon
Statistics
?
PSSM-Id: 197715
View PSSM: smart00421
Aligned: 170 rows
Threshold Bit Score: 47.907
Threshold Setting Gi: 293403435
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*...
2Q0O_A       173 KQMLSPREMLCLVWASKGKTASVTANLTGINARTVQHYLDKARAKLDAESVPQLVAIA 230
gi 75499087  141 KRGLTNREMNIILELFRGGKEDEISMQLNICQKTVSAHKLSALSKVGCKNISHFFLLG 198
gi 75499842  139 PLTLSQTESNMLKISMSGHDTIQISDKMQIKAKTVSSHKGNIKRKIKTHNKQVIYHVV 196
gi 75499684  113 KVRLTANERNVLAMLVKGMDIRQISCELNVHLKTIYSVRYHVLTKLGCRTVLDYQILS 170
gi 75504573   22 PCLLSEIEIELLSQLLKGYSVNEISKRRNRSIKTGSCQKMKLYKKLNVKSDLTLWGDV 79
gi 293403435  24 PGSVSEKERLLLKLLMQGMSVTEISQYRNRSAKTISHQKKQLFEKLGIQSDITFWRDI 81
gi 315298290 134 SVILTLSERKVLRLLGKGWGINQIASLLKKSNKTISAQKNSAMRRLAIHSNAEMYAWI 191
gi 161502896 135 TLSLSRTESSMLRMWMEGQGTIQISDRMNIKAKTVSSHKGNIKRKIKTHNKQVIYHVV 192
gi 291085965 137 TPLLTPQEEKVLSMWMDGVSNNAIAAALSIHGKTVYTYKRNIRMKLHLGNRFSPFLSL 194
gi 300824404  63 SRTLSPTEREILRFMSRGYSMTQIAEQLKRNIKTIRAHKFNVMSKLGVSSDAGLLEAA 120
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap