Conserved Protein Domain Family
MCM

?
smart00350: MCM 
minichromosome maintenance proteins
Statistics
?
PSSM-Id: 214631
View PSSM: smart00350
Aligned: 19 rows
Threshold Bit Score: 701.71
Threshold Setting Gi: 50292801
Created: 13-Jul-2011
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_448833  157 HTLSPGTLNAMYLNKLVSIEGIVTKTSLVRPKLMRS---VHYAEKTGRFHYRdyTDSTTSLTTRVPtpAIYPTedpdgnK 233  Candida glabrata...
P29458     287 KCINMRDLNPGDIDKLISIKGLVLRCTPVIPDMKQAffrCSVCGHCVTVEID--RGRIAEPIKCPRevCGATN------A 358  Schizosaccharomy...
EGA72708   310 SCKGMRELNPNDIDKLINLKGLVLRSTPVIPDMKVAffkCNVCDHTMAVEID--RGVIQEPARCERidCNEPN------S 381  Saccharomyces ce...
NP_011314  272 TVHRIRDIRSEKIGSLLSISGTVTRTSEVRPELYKAsftCDMCRAIVDNVEQ--SFKYTEPTFCPNpsCENRA------F 343  Saccharomyces ce...
XP_528129  267 KTKNMRNLNPEDIDQLITISGMVIRTSQLIPEMQEAffqCQVCAHTTRVEMD--RGRIAEPSVCGR--CHTTH------S 336  chimpanzee
AAA80227   109 KHVSPRTLTASLLGSLVCVEGIVTKCSLVRPKVMRS---VHYCPATKKTLER--KYSDLTSLEAFPssSIYPTkdeennP 183  African clawed frog
AAC37429   139 RPSTIREVKASHIGQLVRISGIVTRCSDVKPLMAVAvytCEDCGHEIYQEVT--SRVFMPLFKCPSsrCRLNS------K 210  thale cress
EAX04367   154 KHVSPRTLTSCFLSCVVCVEGIVTKCSLVRPKVVRS---VHYCPATKKTIER--RYSDLTTLVAFPssSVYPTkdeennP 228  human
BAG37153   145 KPRVIREVRADSVGKLVTVRGIVTRVSEVKPKMVVAtytCDQCGAETYQPIQ--SPTFMPLIMCPSqeCQTNR------S 216  human
CBK39280   223 KPLSVRQIKGDFLGQLITVRGIITRVSDVKPAVEVIaytCDQCGYEVFQEVN--SRTFTPLSECTSeeCSQNQ------T 294  Saccharomyces ce...
XP_448833  234 --LTTEYGF-STYIDHQRITVQEMPEMAQVGPVPRSVDIILDDDLVDKTKPGDRINVVGVFKSVg--A--GGLNQGES-- 304  Candida glabrata...
P29458     359 --MQLIHNR-SEFADKQVIKLQETPDVVPDGQTPHSVSLCVYDELVDSARAGDRIEVTGIFRCVp--VrlNPRMRTVK-- 431  Schizosaccharomy...
EGA72708   382 --MSLIHNR-CSFADKQVIKLQETPDFVPDGQTPHSISLCVYDELVDSCRAGDRIEVTGTFRSIpirA--NSRQRVLK-- 454  Saccharomyces ce...
NP_011314  344 --WTLNVTR-SRFLDWQKVRIQENANEIPTGSMPRTLDVILRGDSVERAKPGDRCKFTGVEIVVpdvT--QLGLPGVKps 418  Saccharomyces ce...
XP_528129  337 --MALIHNR-SLFSDKQMIKLQESPEDMPAGQTPHTVILFAHNDLVDKVQPGDRVNVTGIYRAVpirV--NPRVSNVK-- 409  chimpanzee
AAA80227   184 --LETEYGL-STYKDHQTLSIQEMPEKAPAGQLPRSVDIIADDDLVDKCKPGDRVQIVGIYRCLp--S---KQGGFTS-- 253  African clawed frog
AAC37429   211 agNPILQLRaSKFLKFQEAKMQELAEHVPKGHIPRSMTVHLRGELTRKVSPGDVVEFSGIFLPIp--Yt-GFKALRAG-- 285  thale cress
EAX04367   229 --LETEYGL-SVYKDHQTITIQEMPEKAPAGQLPRSVDVILDDDLVDKAKPGDRVQVVGTYRCLp-----GKKGGYTS-- 298  human
BAG37153   217 ggRLYLQTRgSRFIKFQEMKMQEHSDQVPVGNIPRSITVLVEGENTRIAQPGDHVSVTGIFLPIl-rT--GFRQVVQG-- 291  human
CBK39280   295 kgQLFMSTRaSKFSAFQECKIQELSQQVPVGHIPRSLNIHVNGTLVRSLSPGDIVDVTGIFLPAp--Yt-GFKALKAG-- 369  Saccharomyces ce...
XP_448833  305 -------------NTLnGFRTLIIGNSVYPL-HaRSTGVSAK-------------------------------------- 332  Candida glabrata...
P29458     432 -------------SL---FKTYVDVVHIKKQdKrRLGTDPSTlesdiaed------------------------------ 465  Schizosaccharomy...
EGA72708   455 -------------SLY-K--TYVDVVHVKKVsDkRLDVDTSTieqelmqnk----------------------------v 490  Saccharomyces ce...
NP_011314  419 stldtrgisktteGLN-SGVTGLRSLGVRDLtYkISFLACHVisigsnigasspdansnnretelqmaanlqannvyqdn 497  Saccharomyces ce...
XP_528129  410 -------------SVY-K--THIDVIHYRKTdAkRLHGLDEEa------------------------------------- 436  chimpanzee
AAA80227   254 -------------GT---FRTILLANNIKl----MSKEIAPT-------------------------------------- 275  African clawed frog
AAC37429   286 -------------LVA-D--TYLEATSVTH--FkKKYEEYEFq------------------------------------- 310  thale cress
EAX04367   299 -------------GT---FRTVLIACNVKq----MSKDAQP--------------------------------------- 319  human
BAG37153   292 -------------LLS-E--TYLEAHRIVK--MnKSEDDES--------------------------------------- 314  human
CBK39280   370 -------------LLT-E--TYLEAQFVRQ--HkKKFAs----------------------------------------- 390  Saccharomyces ce...
XP_448833  333 --------ET-LNDLDIRNINKLSK--RGDIFEILAQSLAPSIYGHENIKRAVLLMLFGGVEKNLENGS--HLRGDINIL 399  Candida glabrata...
P29458     466 aalqidevRK-ISDEEVEKIQQVSK--RDDIYDILSRSLAPSIYEMDDVKKGLLLQLFGGTNKSFHKGAspRYRGDINIL 542  Schizosaccharomy...
EGA72708   491 dhneveevRQ-ITDQDLAKIREVAA--REDLYSLLARSIAPSIYELEDVKKGILLQLFGGTNKTFTKGG--RYRGDINIL 565  Saccharomyces ce...
NP_011314  498 erdqevflNS-LSSDEINELKEMVK--DEHIYDKLVRSIAPAVFGHEAVKKGILLQMLGGVHKSTVEGI--KLRGDINIC 572  Saccharomyces ce...
XP_528129  437 -------eQKlFSEKRVELLKELSR--KPDIYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSHTGrgKFRAEINIL 507  chimpanzee
AAA80227   276 -----------FSADDVAKIKKFCKahSKDIFEHLSKSLAPSIHGHEYIKKAILCMLLGGNEKVLENGT--RIRGDINVL 342  African clawed frog
AAC37429   311 -------------kDEEEQIARLAE--DGDIYNKLSRSLAPEIYGHEDIKKALLLLLVGAPHRQLKDGM--KIRGDVHIC 373  thale cress
EAX04367   320 ---------S-FSAEDIAKIKKFSKtrSKDIFDQLAKSLAPSIHGHDYVKKAILCLLLGGVERDLENGS--HIRGDINIL 387  human
BAG37153   315 ---------G-AGELTREELRQIA---EEDFYEKLAASIAPEIYGHEDVKKALLLLLVGGVDQS-PRGM--KIRGNINIC 378  human
CBK39280   391 -------fSL-TSDVEERVM-ELIT--SGDVYNRLAKSIAPEIYGNLDVKKALLLLLVGGVDKRVGDGM--KIRGDINVC 457  Saccharomyces ce...
XP_448833  400 MVGDPSTAKSQMLRFVLNTASLAIATTGRGSSGVGLTAAVTTDRETGERRLEAGAMVLADRGIVCIDEFDKMTDVDRVAI 479  Candida glabrata...
P29458     543 MCGDPSTSKSQILKYVHKIAPRGVYTSGKGSSAVGLTAYITRDQDTKQLVLESGALVLSDGGICCIDEFDKMSDATRSIL 622  Schizosaccharomy...
EGA72708   566 LCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGLTAYITRDVDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVL 645  Saccharomyces ce...
NP_011314  573 VVGDPSTSKSQFLKYVVGFAPRSVYTSGKASSAAGLTAAVVRDEEGGDYTIEAGALMLADNGICCIDEFDKMDISDQVAI 652  Saccharomyces ce...
XP_528129  508 LCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVL 587  chimpanzee
AAA80227   343 LIGDPSVAKSQLLRYVLHTAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRTAI 422  African clawed frog
AAC37429   374 LMGDPGVAKSQLLKHIINVAPRGVYTTGKGSSGVGLTAAVMRDQVTNEMVLEGGALVLADMGICAIDEFDKMDESDRTAI 453  thale cress
EAX04367   388 LIGDPSVAKSQLLRYVLCTAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRTAI 467  human
BAG37153   379 LMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVLRDSVSGELTLEGGALVLADQGVCCIDEFDKMAEADRTAI 458  human
CBK39280   458 LMGDPGVAKSQLLKAICKISPRGVYTTGKGSSGVGLTAAVMKDPVTDEMILEGGALVLADNGICCIDEFDKMDESDRTAI 537  Saccharomyces ce...
XP_448833  480 HEVMEQQTVTIAKAGIHTTLNSRCSVIAAANPVFGQYDVNRDPHQNIALPDSLLSRFDLLFVVTDDINEARDRSISEHVL 559  Candida glabrata...
P29458     623 HEVMEQQTVTVAKAGIITTLNARTSILASANPIGSKYNPDLPVTKNIDLPPTLLSRFDLVYLILDRVDETLDRKLANHIV 702  Schizosaccharomy...
EGA72708   646 HEVMEQQTISIAKAGIITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELAKHLT 725  Saccharomyces ce...
NP_011314  653 HEAMEQQTISIAKAGIHATLNARTSILAAANPVGGRYNRKLSLRGNLNMTAPIMSRFDLFFVILDDCNEKIDTELASHIV 732  Saccharomyces ce...
XP_528129  588 HEVMEQQTLSIAKAGIICQLNARTSVLAAANPIESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDEAYDRRLAHHLV 667  chimpanzee
AAA80227   423 HEVMEQGRVTIAKAGIQARLNARCSVLAAANPVYGRYDQYRTPMENIGLQDSLLSRFDLLFIVLDKMDADNDQEIADHVL 502  African clawed frog
AAC37429   454 HEVMEQQTVSIAKAGITTSLNARTAVLAAANPAWGRYDLRRTPAENINLPPALLSRFDLLWLILDRADMDSDLELAKHVL 533  thale cress
EAX04367   468 HEVMEQGRVTIAKAGIHARLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFIMLDQMDPEQDREISDHVL 547  human
BAG37153   459 HEVMEQQTISIAKAGILTTLNARCSILAAANPAYGRYNPRRSLEQNIQLPAALLSRFDLLWLIQDRPDRDNDLRLAQHIT 538  human
CBK39280   538 HEVMEQQTISISKAGINTTLNARTSILAAANPLYGRYNPRLSPLDNINLPAALLSRFDILFLMLDIPSRDDDEKLAEHVT 617  Saccharomyces ce...
XP_448833  560 RTHRYLSPgmvegepvrdrlnlslavgtdeddenandntnqdeedQVFEKF------------------NP--------- 612  Candida glabrata...
P29458     703 SMYMEDTP-------------------------------------EHATDM------------------EV--------- 718  Schizosaccharomy...
EGA72708   726 NLYLEDKP-------------------------------------EHISQD------------------DV--------- 741  Saccharomyces ce...
NP_011314  733 DLHMKR-----------------------------------------DEAI------------------EP--------- 744  Saccharomyces ce...
XP_528129  668 ALYYQS----------------------------------------EEQAE------------------EE--------- 680  chimpanzee
AAA80227   503 RMHRYRTPgeqdgyal---------------------plgcsveiFATDDP------------------NAsdvtdqelq 543  African clawed frog
AAC37429   534 HVHQTEES--------------------------------------PALGF------------------E---------- 547  thale cress
EAX04367   548 RMHRYRAPgeqdgdamplgsa------------vdilatddpnfsQEDQQDtqiyekhdnllhgtkkkkEK--------- 606  human
BAG37153   539 YVHQHSR--------------------------------------QPPSQF------------------E---------- 552  human
CBK39280   618 YVHMHNK--------------------------------------QPDLDF------------------T---------- 631  Saccharomyces ce...
XP_448833  613 ------------------LLqagamlaknrgnyngtEIPKLVK-ISFLRkyvqyakERVVPQLTTEAVDVIVKNYTDLRN 673  Candida glabrata...
P29458     719 -------------------F----------------SVEFLTSyITYAR-------NNINPVISEEAAKELVNAYVGMRK 756  Schizosaccharomy...
EGA72708   742 -------------------L----------------PVEFLTMyISYAK-------EHIHPIITEAAKTELVRAYVGMRK 779  Saccharomyces ce...
NP_011314  745 ------------------PF----------------SAEQLRRyIKYAR-------T-FKPILTKEARSYLVEKYKELRK 782  Saccharomyces ce...
XP_528129  681 ------------------LL----------------DMAVLKDyIAYAH-------STIMPRLSEEASQALIEAYVDMRK 719  chimpanzee
AAA80227   544 iyekhdnllhgprknkskIV----------------SMQFIRKyIHVAK--------LIKPVLTSEAADYISQEYAKIRN 599  African clawed frog
AAC37429   548 ------------------PL----------------EPNILRAyISAAR--------RLSPYVPAELEEYIATAYSSIRQ 585  thale cress
EAX04367   607 ------------------MV----------------SAAFMKKyIHVAK--------IIKPVLTQESATYIAEEYSRLRS 644  human
BAG37153   553 ------------------PL----------------DMKLMRRyIAMCR-------EK-QPMVPESLADYITAAYVEMRR 590  human
CBK39280   632 ------------------PV----------------EPSKMREyIAYAK-------TK-RPVMSEAVNDYVVQAYIRLRQ 669  Saccharomyces ce...
XP_448833  674 DE-Nt-------kKSPITARTLETLIRLATAHAKVRLSRTVDKVDATVAANLLRFSLL 723  Candida glabrata CBS 138
P29458     757 LG-Edvra--sekRITATTRQLESMIRLSEAHAKMHLRNVVEVGDVLEAARLIKTAIK 811  Schizosaccharomyces pombe 972h-
EGA72708   780 MG-Ddsrs--dekRITATTRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSAIK 834  Saccharomyces cerevisiae AWRI796
NP_011314  783 DD-Aqgf---srsSYRITVRQLESMIRLSEAIARANCVDEITPSFIAEAYDLLRQSII 836  Saccharomyces cerevisiae S288c
XP_528129  720 IG-Ssrg----mvS--AYPRQLESLIRLAEAHAKVRLSNKVEAIDVEEAKRLHREALK 770  chimpanzee
AAA80227   600 HD-Qinng--sarTMPVTARALETMIRLSTAHAKVRMSKTIERQDAETALELVQFAYF 654  African clawed frog
AAC37429   586 EE-Aksnt----phsYTTVRTLLSILRISAALARLRFSESVAQSDVDEALRLMQMSKI 638  thale cress
EAX04367   645 QD-Smssd--tarTSPVTARTLETLIRLATAHAKARMSKTVDLQDAEEAVELVQYAYF 699  human
BAG37153   591 EAwAskda--tytS----ARTLLAILRLSTALARLRMVDVVEKEDVNEAIRLMEMSKd 642  human
CBK39280   670 -D-SkremdskfsFGQATPRTLLGIIRLSQALAKLRLADMVDIDDVEEALRLVRVSKe 725  Saccharomyces cerevisiae EC1118
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap