4EGC


Conserved Protein Domain Family
SIX1_SD

?
pfam16878: SIX1_SD 
Click on image for an interactive view with Cn3D
Transcriptional regulator, SIX1, N-terminal SD domain
SIX1_SD is a family of eukaryotic proteins, and it is found N-terminal to the Homeobox domain. As a transcription factor it lacks intrinsic activation domains and thus needs to bind to the EYA family of co-factors in order to mediate transcriptional activation. It is the SD domain that is necessary for this protein-protein interaction, binding to the C-terminal region of EYA - Eyes absent homolog proteins.
Statistics
?
PSSM-Id: 339841
View PSSM: pfam16878
Aligned: 73 rows
Threshold Bit Score: 122.222
Threshold Setting Gi: 942119157
Created: 15-Apr-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4EGC_A       379 FTQEQVACVCEVLQQGGNLERLGRFLW-SLPA-Cdhl----hkNESVLK----------------AKAVVAFHRGNFREL 436
O17894        97 YSMEQMEAISTSLFQARDGDRLVAFFK-QLESlYgpnavdhlrSEAIIV----------------AYTYALYHSNEFETL 159 Caenorhabditis ...
XP_003112454 120 nyqfQMEAICTSLFQARDGERLVAFFN-QLKTvYgsnaldhfgSEAIVVgeespvkmelrvddlyAYTYALYHSNDFERL 198 Caenorhabditis ...
XP_002637837  93 YNLDQMEAICTSLFQARDGERLVAFFN-QMKEmYgsnaldhfgSESIVV----------------AYTYALYHSNDFERL 155 Caenorhabditis ...
EGT34079     116 YSIEQMEAIATSLFQARDGERLVSFFN-QLKAiYgatalnqivSEPILV----------------AYTYALYHSNDFEQL 178 Caenorhabditis ...
XP_003112448   1 --mNQMEVICTSLFQTRDGERLVRFFD-QVESvYgvnslerfgSEPMVV----------------AYAYALFHSNNFTKL 61  Caenorhabditis ...
ERG84713      37 FSSDQIDCICEALYQARNGEKLVELFRpDIQNiMfyr---crySSSVLR----------------AYLYTLFHTRRFEEL 97  pig roundworm
XP_003145294  20 FSSDQIDCICEALYQARDGEKLLELFQpNVHNvMyyrc--ryySSSVLR----------------AYLYALYYGKRYEEL 81  eye worm
KRZ11069      22 YTDEQLMCICETLCQAKDYPSICRLFDyLYPNeYlh-----stHPSLMR----------------ARLLYLLMKCRFKEI 80  Trichinella zim...
CDS30710      17 qsPDQLLYLCEVVQKSEDYSRLHQLLAycrdaa----ppnvqqSDTVVK----------------CLAVLALLEGRYQDV 76  Hymenolepis mic...
4EGC_A       437 YKILESHQFSPHNHPKLQQLWLKAHYVEAEKLR--GRPLGAVGKYRVRRKFPLP 488
O17894       160 FHLLSNRHFQQRHYNDLQDIWHHARYKESQLKR--GKELNPVEKYRLRRKFPAP 211 Caenorhabditis elegans
XP_003112454 199 FHLLSTRHFQQIYFTDLQEIWHYARYKESQLKR--GKELNPVEKYRLRRKFPPP 250 Caenorhabditis remanei
XP_002637837 156 FHLLSTRHFHATFFADLQEIWHYARYKESQLKR--GKELNPVEKYRLRRKFPPP 207 Caenorhabditis briggsae
EGT34079     179 FNLLATHSFQHIYFNDLQDIWHHARYRESQLKR--GKELNPVEKYRLRRKFPPP 230 Caenorhabditis brenneri
XP_003112448  62 YNLLSTRNFDKKYFDDLTKIWYEAKYKEAQLNRksGEELTAVERHRLRKRTELP 115 Caenorhabditis remanei
ERG84713      98 FQAIAANTFEQKYFEELQDLWYKARYAENEQRR--QKELGAVEKYRLRKKHPPP 149 pig roundworm
XP_003145294  82 FQTIASNTFEQRFYNELQDLWYKARYAENEERR--QKELGAVEKYRLRKKHPPP 133 eye worm
KRZ11069      81 YDLLSSSVFDSRYHEELQEIWWQAHYAELEQAR--CKPLGAVEKYRLRKKHPPP 132 Trichinella zimbabwensis
CDS30710      77 FAILQTRYFAPRHHARLQELWLRGHYEEAEQAR--GCSLSAVGRHRLRKKHPLP 128 Hymenolepis microstoma
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap