Conserved Protein Domain Family
SPACA7

?
pfam15307: SPACA7 
Sperm acrosome-associated protein 7
SPACA7 is a family of eukaryotic proteins expressed in the testes. Proteins in this family are typically between 104 and 195 amino acids in length. There is a conserved DEIL sequence motif. The function is not known.
Statistics
?
PSSM-Id: 339461
View PSSM: pfam15307
Aligned: 5 rows
Threshold Bit Score: 123.166
Threshold Setting Gi: 81905932
Created: 18-Apr-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81904897   19 WQGaelQPIKTTSGPI-TEGS-LNSTTENIPEALDEILAQEILEPktsavSETSPRPRSSILTTVQTKeINAG---IDEN 93
gi 74745537    8 WDG---DPVSQVAGSP-TEIP-FSSKQEDMSELLDEILVQEILDL-----NKTTPSEMPSTASTLSTP-LHAG---IDEN 73
gi 81905932   19 WQDvqpWPNRELSGSSgKQWPnLETLDDDIATVFDEILVRDILEPgkapyFENQSPSTTSQQKTTKEKeVHTKepiPSKT 98
gi 795348548  19 WQEtelRPRIATPGST-TEIP-FSSKHEDVPELLDEILVQEILDM-----NKTTWTEMPSTASTLST--IHAG---IDEN 86
gi 545538079  17 WHEaklQPINMTSGPS-TEMPpRSKGQEDIPGVFDEILVQEMLDP-----NKSSKAAKQRTASPLSTKfFKDKntiMDET 90
                         90       100       110
                 ....*....|....*....|....*....|....*...
gi 81904897   94 YQEEAFENYHEVLENIEHLPTKEESGKNDRSTV-ANLH 130
gi 74745537   74 YQAGGSENYHELLENLQFSPGIEVKISNDEANAnANLH 111
gi 81905932   99 YQKQSS-------SGTMHTPSFDDKQK-------EILF 122
gi 795348548  87 YQAGGSENYHELLENLQFSSGTEDKVSSDEASAnANLH 124
gi 545538079  91 FQVGAPQSYHGLSDNSQFSIGNEDKIFNNEHSIdesyq 128
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap