Conserved Protein Domain Family
Cylicin_N

?
pfam15241: Cylicin_N 
Cylicin N-terminus
This is the N-terminus of cylicin proteins, which may play a role in spermatid differentiation.
Statistics
?
PSSM-Id: 317623
View PSSM: pfam15241
Aligned: 23 rows
Threshold Bit Score: 142.907
Threshold Setting Gi: 612058811
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 532086412 176 DVNIRTYANPIPISETSGKSWNQEHFAWTFPKPSMPSRKEKSRPSELQI--TVSR-QDQRKLEEGQKPaHIWIRHSFRKI 252
gi 752426506  23 KINFGTYDNYIPVSELSKKSWNQQHFALGFPKPPRPGKKRRSKPSQLRDn-AVLV-HDSDKIKEGPKR-PLWMHSSLMRI 99
gi 344271556  28 KINFGTYDNYIPVSELSKKSWNQQHFALVFPKPPRPGRKRRSMPSKLQAn-ADSV-IDEEKPKEGKRR-PLWMHRSLMSI 104
gi 672019321   8 KVTYGAYDNYIPVSELSKKSWNQQYFSLAFPKPPRPGKKRRSLPSQLQNn-PAPV-IDEQKL-GIHKP-PLWMHRSLMRI 83
gi 817304118   8 KVNFGTYDNYIPVSELSKKSWNQQHFALSFPKPQRPGKKRRSKPSQIRDn-TVPK-IDEEQLRGGHRR-PLWMYRSLMRI 84
gi 655599552   8 KINFGTYDNYIPVSELSKKSWNQQHFSLAFPKPQRPGTKRRSKPSQLRDn-TAPV-IDEEKLRS-RKQ-PLWMHRSLMRI 83
gi 884916763   8 KINFGTYDNYIPVSELSKKSWNQQHFSLAFPKPQRPGKKRRTIPSQLNKs-VPPPtVDEEKVKSEDRR-PLWMHRSLTKI 85
gi 395824323  36 KINFGTYDNYIPVSELSKKSWNQQHFALVFPKPPRPGKKRRTKPSQLQEnvV--K-IDEDQ--PAHRR-PLWMHHSLMRI 109
gi 927098774  61 KINFGTYDNYIPVSELSKKSWNQQHFALVFPKPPRPGTKRRSKPSQLRDs-TIPK-YDEEKLRGDHRR-PLWMYRSLMRI 137
gi 27805831    8 KINFGAYDNYVPVSELSKKSWNQQHFALVFPKPPRPGKRRRSKPSLLQEn-TSPK-YDAEKLRGDRKQ-PLWMHRSLMRI 84
                         90       100       110
                 ....*....|....*....|....*....|.
gi 532086412 253 FQRPSIYLAIGIQA-PFRHHYNPKTRDIRAE 282
gi 752426506 100 SERPSEYLAARRQR-PYKPTHHPKEDAKVAD 129
gi 344271556 105 SERPSVYLAARRRP-VSKPTSTPKKSSKEAD 134
gi 672019321  84 SERPSVYLAARKSL-PPKPPRFGKGEFKRAG 113
gi 817304118  85 SERPSVYLAARRQ--PLKPTRTAKVDSKAAd 113
gi 655599552  84 SERPSDYLAARRKP-PPKPTPSPKGAGEKPS 113
gi 884916763  86 SERPSVYLAARRKS-LPKPAPSPKADsvppk 115
gi 395824323 110 SERPSVYLAARRKP-PEKPVPPPKLDIRGtq 139
gi 927098774 138 SEKPSVYLAARRQPvPMKPTGPSKGDAKSVg 168
gi 27805831   85 SERPSVYLAARSRH-PQKETPPSQEDAKQAA 114
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap