Conserved Protein Domain Family
TMEM210

?
pfam15195: TMEM210 
TMEM210 family
This family of proteins is found in eukaryotes. Proteins in this family are typically between and 149 amino acids in length. The function of this family is unknown.
Statistics
?
PSSM-Id: 317591
View PSSM: pfam15195
Aligned: 10 rows
Threshold Bit Score: 161.14
Threshold Setting Gi: 562870788
Created: 28-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182705197  32 TYCECSLGLSREALIALLVVLAGISASCFCALVIVAIGVLRAK--GETC-PRQVDNRLVENFGVQEDLMDLHPVYVESQL 108
gi 81904853   32 TYCECSLGLSREALIALIVVLAGVSASCFCALVVVAIGVFRAK--GDTC-PGHSENRLVGPYGVQEDRIDLHTVHVESHL 108
gi 545512515  32 TYCECSLGLSREALIALLVVLAGISASCFCALVIVAVGVMRAK--SEPC-PRHRDSRLVGHFGVQEDHMDLHSVQVESQL 108
gi 281345343  32 TYCECSLGLSREALIALLVVLAGVGASCFCALVIVAVGVMRAK--SEPC-PRHMNSRLVGRYGVQEDRMDLHTVQVESHV 108
gi 545204278  32 TYCECSLGLSREALIALLVVLAGVSASCFCALVIVAVGVLRAK--GETC-PGHMDSRLVGHFGVQEDHMDLHTVHVESHL 108
gi 742077740  15 AYCECSLGLSREALIALLVVLAGISASCFCALVIVAVGVIRAK--GETC-PAHMDSRMVGHFGVQEDRMDLRTVHVESHL 91
gi 914923274  32 TYCDCSLGLSREALIALIVVLAGVSASCFCALMVVALGVLRAK--GEPS-TRHVDNRLVGHFGVQEDRMDLHAVHVESHL 108
gi 562870788  32 nYCECSLGLSREALVALIALLAGVSASCFCALVIVAVGILRAK--NEPPcPGRMDNRVVGHFGVQEDRMDLHTVHVESHL 109
gi 831234108  32 TYCECSLGLSREALIALIVVLAGVSATCFSALVIVAIGVMRAK--G-CVsPEHTDNRLVGHFGVQEDQMDLRTVHVESHL 108
gi 410979587  32 TYCECSLGLSREALIALLVVLAGVGASCFCALVIVAIGAMRAKrhEHAS-RRHMDSRMVGHFGVQEDHTDLHTLHVESHL 110
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*
gi 182705197 109 MDADLEVSLVPPLEDQSLVAipMEA-----SSEEPP-----PPPP 143
gi 81904853  109 MDPDLDVSMMPSLDGPGLMT--MTA-----PLEPPP-----PPPP 141
gi 545512515 109 MDPELEVSMMTPLEDQGLMSipTDSmaqsvtiedpslsratgslg 153
gi 281345343 109 MDPDLEVSMMLPLEEQGLMTipIDPmapnvTVEEQP-----PLTP 148
gi 545204278 109 VDPDLEVSMMPALEDHGLMAipMDS-------RAPSvtleePPCP 146
gi 742077740  92 MDPDMAVPMMQPLEEHGLMTitMDP-----TLEEPP-----PPPE 126
gi 914923274 109 MDPELEVSMMPSLEDHGLMTipMEA-----TLEEPppppppe--- 145
gi 562870788 110 MDPDLEASTMPPLEDHSLLT--MEA-----SLEEPP-----PPPP 142
gi 831234108 109 LDPDLEVSTMPPLEDHSLGNisMEA-----SLEEPP-----PPLP 143
gi 410979587 111 MDPELEVSLMPPLEAHGLITipMDPmaptlTLEEPS-----PLTP 150
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap