Conserved Protein Domain Family
CLAMP

?
pfam14769: CLAMP 
Flagellar C1a complex subunit C1a-32
This family represents one small subunit, C1a-32, of the C1a projection (the seventh projection of flagellar). Numerous studies have indicated that each of the seven projections associated with the central pair of microtubules in flagellar plays a distinct role in regulating eukaryotic ciliary/flagellar motility. The C1a projection is a complex of proteins including PF6, C1a-86, C1a-34, C1a-32, C1a-18, and calmodulin. C1a projection is involved in modulating flagellar beat frequency and this is mediated via the C1a-34, C1a-32, and C1a-18 sub-complex by modulating the activity of both the inner and outer dynein arms.
Statistics
?
PSSM-Id: 339368
View PSSM: pfam14769
Aligned: 67 rows
Threshold Bit Score: 58.7131
Threshold Setting Gi: 303275794
Created: 12-Apr-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121971346   70 QLYRFMNSQNYTAEQKSTLMS---LAYEIFIKSME--KKM-TQIDSFNLLKQALH---------------EQTKIFSTQT 128
gi 123475396   78 DAILFASDTQITYSKSIVFLT---LYIAMLQQVIF--QPYyQPEKLLKKFEHALL---------------IHSVERPPSS 137
gi 154420376   78 DAILFTADNTFPYAKSIVFLT---IYITFLQQAII--QSHyEPEKLYRQYERILL---------------KHSVERPPHS 137
gi 159110250   50 NTFDFSRTHLASSDAACALVT---LLVDLHELNIS--KTFiSYEDLREFAKKRLV---------------GYSLECPPFY 109
gi 1084290551  44 EAVNFARKENFSFSQLCALVS---VTNRVLKELSS--SPFdDIQNVLNVSDKIMM---------------SYSIQRPPHC 103
gi 575485560  127 SNYYFSKENKFSPIQISVFFS---IMKLTLDKSLE--KSLtHT-QTLSEFKKLLFdslaepsspailansTNQIEDPTSS 200
gi 255088079   74 NALDFARDAGLTPAQTVAVHE---VGQAMLDACAVepGPSfVFADAESLFQSTIL---------------PKVAAEPDRE 135
gi 303275794   79 NTLSFARDGGFSVAQTHALFD---LALLLLKIAAD--DDv-DFTAAEGYFKNRLV---------------MNVSATP--A 135
gi 1004399292 109 SVTKFCTSASYTVEQTGALLSqfyLTHLFFTSVLD--V---GPEKLYEYFKGLQM---------------CHSLPFPPHS 168
gi 302849487   56 YSLDFAHKQSFGPTRKASWYN---VAHRVLQTCIG--Ga--PYEECEACFKGLML---------------QLVRPRPGTD 113
                          90       100       110
                  ....*....|....*....|....*....|....*
gi 121971346  129 IPIFTQQHCKNVIDFIKGSFYRYYSLYELTMTKFI 163
gi 123475396  138 SGIFDISDIKILQEFFITKFFRNAKMIQYCFTKRP 172
gi 154420376  138 SGIFDLPDVKLIHDFFINSYFRNVKLIQNCLSKRH 172
gi 159110250  110 TAFFEMDVIKATAEFIDFSYTNNYKLWRYLFCPVP 144
gi 1084290551 104 TELFSIADSLKCVEFLVDSLFRHWRLYKFALAPTa 138
gi 575485560  201 I--FEPAECKLIIDYAMTTLFQHFKLFHYVFNNDQ 233
gi 255088079  136 GGQFSVTDVRAVSDYFAKGFFQHFSLWRFVWSEEQ 170
gi 303275794  136 EGKFTVDDVKVISAHFASGFFAHFKLFAFMYRRAQ 170
gi 1004399292 169 IKLFNLEQIKNNMVYFCKLYLRNLPLVRrrst--- 200
gi 302849487  114 TPYFSPDQVAAVGGFMAHGLFRHYRLYQHVFSTEQ 148
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap