Conserved Protein Domain Family
Prok-RING_2

?
pfam14445: Prok-RING_2 
Prokaryotic RING finger family 2
RING finger family found sporadically in bacteria and archaea, and associated with other components of the ubiquitin-based signaling and degradation system, including ubiquitin and the E1 and E2 proteins. The bacterial versions contain transmembrane helices.
Statistics
?
Aligned: 3 rows
Threshold Bit Score: 102.637
Threshold Setting Gi: 153998290
Created: 29-Apr-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Mboo_0190    12 DPHSFAQFTCDLCNTAHPIAELRQCVLCGRWACNACWKDEYYTCRSCAGLIKIHQL 67  Methanoregula boonei 6A8
Q2FKZ9           22 DPESFSRYVCDLCHSSGSLSGLRQCVICGRWGCSSCWQDEYYLCKSCGGIMNLLLL 77  Methanospirillum hungatei JF-1
jgi:Metfor_0002  42 DPRTFSQYLCDLCATPHPVTGLRQCVLCGRWACDACWKDDYYTCKSCAGLIRIHSL 97  Methanoregula formicica SMSP
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap